KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162494
Entry
110162494         CDS       T05002                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04020  Calcium signaling pathway
bpec04260  Cardiac muscle contraction
bpec04261  Adrenergic signaling in cardiomyocytes
bpec04270  Vascular smooth muscle contraction
bpec04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110162494
   04020 Calcium signaling pathway
    110162494
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110162494
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110162494
   04261 Adrenergic signaling in cardiomyocytes
    110162494
   04270 Vascular smooth muscle contraction
    110162494
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bpec04040]
    110162494
Ion channels [BR:bpec04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110162494
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 110162494
NCBI-ProteinID: XP_020783056
LinkDB
Position
Unknown
AA seq 2039 aa
MRDGASVFDLLLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQ
VVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVYSHTGLNAEEKPAPCA
PNGGYGRHCTRNGTECTMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAM
GYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKG
YLDWITQAEDIDPENEDDGLDDDKPRNCKNHRFKSLRGAVKKNAAILRKALSMPASENES
VNTDNAPGADVEGEACCTRLANRISKSKFSRYSRRWNRLFRRKCRAGVKSQVFYWLVIFL
VFLNTLTIASEHHQQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDS
FVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIAS
LLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDG
IMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKER
KKLARMTSPEKRNENEKPPLEEEKKEKIELKSITSDGETNNATKINMDDYIVDENEDKNP
YPANDYMGDDDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRVLCHKI
VNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYG
AFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLK
HVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFFCTDSSKQTEADCRGSYIMY
KDGDVGKPERAQRHWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIY
NYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKA
RPLRRYIPKNPYQYKVWYVVNSSYFEYLMFTLILLNTICLAMQHHGQTKSFNDAMNILNM
LFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSIVDIAITEVNPAETQSQSSESA
DSSHSSSSHPPVVRPMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKS
FQALPYVALLIVMLFFIYAVIGMQMFGKIALRDNTQINRNNNFQTFPQAVLLLFRCATGE
AWQEIMLACSRMRPCEKGSTHEHNSTHHEDCGSQFAIIYFVSFYMLCAFLIINLFVAVIM
DNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPH
RVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRT
SMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLR
TLHDIGPEIRRAISGDLAVEEELDKGLKEAVSAASEDDIFRVKRSGGLFGNHVNYYNQSD
GRASFPQTFTTQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSGSNANINNANNT
GMVPGTGSRFPSPTISTVDGHTGQPLTPILLPRSAWCFPPKRTCFYDSLMRSDSSDSRLP
IIRRGEGSMEETYDESYADDREYQEDTHSLSSDMLVYQDDTCKQLTPMEEVEEVEERRPG
GGWQSPRRVFLCPTSLGRRSSFHLECLRRQSKPDVSQKTAVPLHLVHHQALAVAGLSPLL
RRSHSPTLFSRLCSTPPASPTALSGEASYQRVPSLRLEGASSHEKLNTSLPSVNCGPWYN
DSNGNSRAPTPSTSGARAPRPVSLTVPSLLGTDSCSLSHGSAGSLVEAVLISEGLGQFAQ
DPSFIEATKAELADACDMTIEEMEHAANNILNGNTAAQASPSPLCGLRPHSPHSPLRPPA
PLTPREGSAEGPSSVEERQELLGPGTGAEEEEEEHSSLLRVEGQRNSALIEDDECVTSL
NT seq 6120 nt   +upstreamnt  +downstreamnt
atgcgagatggtgccagtgtgtttgacctgctgttgttcagcgcgatcttggagcaggcg
acgaagggggacggggccactcccatcggggggaaggctgcaggcttcgacgtcaaagcc
ctccgagcgttcagagtcctgcgcccgctacgcctcgtctccggagtacccagtttacag
gtggtgttgaactccatcatcaaagccatggtccccctgctgcacatcgctctgctcgtc
ctcttcgtcatcatcatctacgccatcatcggcctcgagctcttcatgggcaagatgcac
aagacctgcgtttacagccacacagggctgaacgcggaggagaagccggccccctgcgct
ccgaacgggggctacggcagacactgcacgaggaacgggacggagtgcacgatggggtgg
gaggggcccaacgacggcatcacgaacttcgacaacttcgccttcgccatgctcaccgtg
ttccagtgcatcaccatggagggctggaccgacgtgctgtactggatgcaggatgctatg
ggctatgagttgccgtgggtctattttgtctctctggtcatcttcggctcctttttcgtt
ctcaatctggttctgggtgtgttgagcggagagttttccaaagaaagagaaaaggccaag
gcgcgaggagacttccagaaactgagagagaaacagcagctggaggaggacctcaagggc
tatttagactggatcactcaggcagaagacatcgacccagagaatgaagacgacggactg
gacgacgacaagcccagaaactgtaagaatcaccgctttaagtctctgcgcggcgccgtc
aagaaaaacgccgccattcttcgtaaggcgttgagtatgccggcgagcgaaaacgagtcc
gtcaacacagacaacgcgcccggagccgacgtggagggggaggcctgctgcacacggcta
gcaaataggatctccaaatccaagttcagtcgttactcgcggcgatggaacagactgttt
aggaggaagtgcagagcgggcgtcaaatcccaggttttctattggctcgtcatcttcctg
gttttcctcaacacgttaaccatcgcctccgagcaccaccagcagccgcagtggttaaca
gatgtacaagatatcgccaacaaagttttactagccctcttcactggcgagatgctgttg
aagatgtacagcttaggactccaggcgtattttgtttcgctgttcaatcgcttcgacagc
ttcgtggtttgtggtgggatcctggagaccattttagtggaaaccaagatcatgtctcct
ctgggcatctccgtgctccgatgtgtgaggctgctcagaatattcaaaataacaagatac
tggaactccctgtccaacctggtggcgtctctgctgaactctgtgcgctccattgcttct
ctgttgctgctgctcttcctcttcatcatcatcttctctctcctcgggatgcagctgttc
ggaggaaaattcaacttcgacgaaacgcgacggagcacgttcgataacttcccccagtca
ctgctcactgtgtttcagatcctgacaggtgaggactggaactctgtgatgtacgacggg
atcatggcgtacggaggtccctcttttccagggatgttggtttgcatctacttcatcatc
ctcttcatctgcggaaactacatcctcctgaacgtcttcttggccatcgccgtggacaac
ctggccgacgccgagagcctgacgtctgctcagaaagaggaggaggaggagaaggagagg
aagaaactggccagaatgaccagtcctgagaagcgtaatgaaaatgagaaaccgcctctg
gaagaagagaagaaggaaaagatcgagctcaagtccattacttcagatggagagaccaat
aacgccacaaagatcaacatggacgattacattgtggatgaaaacgaagataagaatcca
tatcctgcaaacgattatatgggagacgatgacgacgaggagccggagatgcccgttgga
cccaggccgcgccctctgtccgacatccagctgaaggagaaggctgtgcccatgcccgag
gccagagccttctttatattcagccacaccaacaaattcagggttttgtgtcataaaatc
gtcaaccacaacatcttcaccaacctcatcctgttcttcatcctgctgtccagtatcagc
ctggcagccgaggaccccgtcaagaacgactccttcaggaaccagatcttgggctatgca
gatcacgtcttcactggcctcttcactatcgagattattctaaagatgacggcctatgga
gctttcttgcacaagggttcattttgcagaaactattttaatattttggacctggtggtt
gtcagtgtgtccctcatttcatcaggaatacagtccagtgccataaatgtggtgaagatc
ctgagagttttgagagttcttcgaccactgagagccatcaaccgagccaaagggttaaag
catgtagtacagtgtgtgtttgtggccatccgaaccatcgggaacatcgtcatcgtcacc
acactgctccagttcatgttcgcctgtatcggagtgcagcttttcaagggcaagtttttc
ttctgcaccgacagctcgaaacagactgaggcagactgcaggggctcgtacatcatgtat
aaagatggagatgtggggaaaccggagcgagcgcagagacactgggagaacagtgacttc
aactttgacgacgtgcttcagggaatgatggctctgtttgctgtgtccacgtttgagggc
tggcctgggctgctgtatcgggccatagactctcatgcggaggacgtggggcccatctac
aactaccgcgtggtcatctccatcttcttcatcatctacatcatcatcatcgccttcttc
atgatgaacatcttcgtcggtttcgtcatcgtcacgtttcaggagcagggagagcaggag
tacaagaactgtgagctcgacaagaaccagcgtcagtgtgtggagtacgccctgaaggcc
cggcccctgcgtcgctacatccccaaaaacccgtatcagtacaaggtctggtacgtggtc
aactcctcgtacttcgaatacctgatgttcaccctcatcctcctcaacaccatctgtctg
gccatgcagcatcacggtcagaccaaaagcttcaatgacgccatgaacattctgaacatg
ctcttcactggactcttcactgtggagatgatcctcaaactcatcgcctttaaacccagg
cattattttgttgatgcatggaacacatttgatgccttaatagttgtgggtagcattgtt
gacatagcgatcactgaggtcaacccagctgagactcagagtcaaagctcggagtccgct
gattcgtcccactcttcctcctcccacccccctgtggtaagaccaatgggactgcagaat
tctgaagagaacgccaggatctccatcaccttcttcagacttttccgcgtgatgaggctg
gtcaagctgctgtctcgcggggaggggatacggaccctgctgtggactttcatcaaatcc
tttcaagctctgccctacgtagctctacttatagtgatgcttttcttcatatatgccgtt
attgggatgcagatgtttggtaaaatagctcttcgggacaacactcagatcaacaggaac
aataatttccagacctttcctcaggcagtgctgctcctgttcagatgtgcgacaggcgag
gcatggcaggagatcatgctggcctgttctcggatgcgcccgtgcgaaaagggctccact
cacgagcacaacagcacccaccacgaggactgcgggagccagttcgccatcatctacttc
gtcagcttctacatgctctgtgcctttctaattattaacctgttcgtggccgtcatcatg
gacaacttcgactatctgactcgggattggtcgatcttggggcctcatcatctcgacgag
tttaagagaatctgggccgaatacgacccagaggccaagggcaggataaaacacctggat
gtggtgacgttgctccggagaatccagcctccgcttggatttggaaaactgtgtcctcat
cgagtggcctgcaaacgtctggtgtccatgaacatgcccctgaacagtgacgggacagtg
atgttcaatgccactctgttcgcgctggtcagaactgctctcaggataaagaccgaagga
aaccttgaacaggccaatgaggagctgagggccatcgtgaagaagatctggaagagaacc
agcatgaaactcctcgatcaagtggtgccccctgctggagatgacgaggttacggtcgga
aagttctacgctacgttcctcatccaagaatatttccgaaaattcaagaagaggaaagaa
caggggctggtggccaaggtgcctcccaaaacggccctttctctgcaggcgggcctgcgg
acgctccacgacatcgggccagagattcggagggcgatctctggggacctggctgtggag
gaggagctggacaaggggctgaaggaggctgtgtctgccgcctcagaggatgacatcttc
agggtaaagcgctcaggggggctgttcggcaaccacgtgaactattacaaccagagcgac
gggcgcgcctctttcccgcaaaccttcaccacccagagaccactgcacatcagccagaag
gggtcgccgtgtgagggggagagcccgtcacacgaaaaactcatggactccaccaccttc
accccctcctcctactcctcctccgggtccaacgccaacatcaacaacgccaacaacacg
ggcatggtcccaggcacgggcagccgcttccccagccccaccatcagcaccgtggacggg
cacacggggcagcccctcacccccatcctgctcccgcgctccgcctggtgcttcccgcca
aagaggacgtgtttttatgactccctcatgcgttcggactctagtgacagccgcctgcca
atcatccgcagaggggaggggtcgatggaggagacgtacgacgagagctacgccgacgac
agggagtaccaggaggacacgcactcgctctcctctgacatgctggtgtatcaggacgac
acgtgtaaacagctgacgccgatggaggaggtggaggaggtggaggagcggagacctgga
ggaggctggcagtcccccagacgagtgttcctctgccccacgtctctggggcggagatcg
tcgtttcacttggagtgtctcaggagacagtcaaagcctgatgtttcccaaaagacagca
gtccctttgcacctcgtacatcaccaggctttggcggtcgcagggttgagtcctctcctc
agacggagtcactctcccactctcttcagtcggctgtgctccacgcctccagccagcccc
accgctctcagcggtgaagcctcttaccagcgggtaccctccttgaggctagagggcgct
agctcccatgaaaagctcaacaccagtttgccctcagtgaactgcgggccctggtacaac
gacagcaatgggaacagccgggcgcccacccctagtacctccggagcccgagcccctcgg
cccgtgtccctcacagtgccctctttgctgggcacagactcgtgctccctgtcccacggc
agcgcggggagcctggtggaggcagtgctaatatcagaaggcctggggcagttcgcgcag
gacccgtccttcatcgaggcgaccaaagcggagctcgccgacgcctgcgacatgaccatc
gaagagatggagcacgccgccaacaacatcctgaacggaaacacagcggcacaggccagc
ccctcccccctctgcggcctgaggcctcacagtcctcacagccccctccgcccccccgcc
cccctcaccccgagggagggcagtgcggaggggccctcctctgtggaggagcggcaggag
ctgctgggtcctgggacaggtgcagaggaggaggaggaggagcacagctctctgctgcga
gtggagggccagaggaacagtgcgctgatagaggacgatgagtgtgtgaccagtttgtag

DBGET integrated database retrieval system