KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162539Help
Entry
110162539         CDS       T05002                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04012  ErbB signaling pathway
bpec04068  FoxO signaling pathway
bpec04150  mTOR signaling pathway
bpec04270  Vascular smooth muscle contraction
bpec04510  Focal adhesion
bpec04810  Regulation of actin cytoskeleton
bpec04910  Insulin signaling pathway
bpec04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110162539 (braf)
   04012 ErbB signaling pathway
    110162539 (braf)
   04068 FoxO signaling pathway
    110162539 (braf)
   04150 mTOR signaling pathway
    110162539 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110162539 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110162539 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110162539 (braf)
   04914 Progesterone-mediated oocyte maturation
    110162539 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110162539 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110162539 (braf)
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110162539 (braf)
Protein kinases [BR:bpec01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110162539 (braf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 110162539
NCBI-ProteinID: XP_020783095
LinkDB All DBs
Position
Unknown
AA seq 833 aa AA seqDB search
MAAVSSAESPPAVFNGAEAVDREPAGRERGLDELDAACPTELSGGPQDEEVGPGEEIWNI
KQMIKLTQEHLEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAMGNGTELS
SSPTAGTGGLGGTAGTGGALDLQEPCAHTFTSAPNTLNVIQTPCDVSRVNPRSPQKPIVR
VFLPNKQRTVVPARCGMTVRDSLKKALMMRGLIPECCAVYRVQDGEKKPIGWDTDISWLT
GEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPL
MCVNYDQLDLLFVSKFFEHHPFSQEEVSSEGTTPVSEVCPSLPPSDSTRSLCHASVSPSK
SIPIPPSFRQSAEEEHRNQFGQRDRSSSAPNVHINTIEPVNIDDLLGGQSLQRSDGAALS
ARPCRAGVRRQRTRTCSPLLYSFPNDIVFDFETEPDFGGSTSGLSATPPASLPGSLTNVK
MPQKSPCPQRERKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGSGSFGTVFKG
KWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQLAIVTQWCEG
SSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGD
FGLATVKSRWSGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIVLYELMSGAL
PYSNINNRDQIIFMVGRGYLSPDLSKIRSNCPKAMKRLMAECLKKKREERPLFPQILASI
ELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFSAFK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgagcagcgcggagtctccaccggccgtgttcaacggagccgaggccgtg
gaccgagagcccgcgggccgggagcgggggctggacgagctggacgccgcctgcccgacg
gagctcagcggaggcccgcaggacgaggaggtaggccccggggaggagatctggaacatt
aaacagatgatcaaactgacccaggagcatctggaggctctgctggacaagtttggagga
gaacacaaccccccgtccatctacctggaggcgtatgaggagtacacgtctaagctggat
gccctgcagcagagggagcagcagctgttggaggcgatggggaacggcacggagctgtcg
tcctcccccacggcgggcacggggggcttggggggcacggcaggcacagggggcgcgctg
gatctgcaggaaccgtgcgctcacactttcacctcggcgccgaacactttaaacgtgatc
cagaccccgtgcgacgtgagccgggtcaacccccgctccccccagaaacccatcgtccga
gtgttcctgcccaacaagcagcgcacagtggtccccgctcgttgtggaatgacggtcaga
gactcgctgaaaaaggctttgatgatgagaggcctgatcccagaatgctgcgccgtctac
agagtccaggacggggagaagaagccgattggttgggacacagacatctcgtggctgacg
ggagaagagctccacgtggaggttctggagaacgtccccctcaccacacacaactttgtg
cgtaaaaccttcttcacgttggcgttttgtgacttttgccggaagcttctgttccagggt
tttcgttgtcaaacctgcggctacaaatttcaccaacgctgcagtacagaggtccccctg
atgtgtgtcaactacgaccagctcgatttattgttcgtgtcaaagttcttcgagcaccat
ccgttctctcaggaggaagtctcctcagaaggaaccaccccagtgtctgaagtctgcccc
tccctgcccccctcagactccaccaggtcgctgtgccacgcctccgtctcgccctccaag
tccatcccgatcccgcccagtttccgacagagcgcggaggaagaacaccggaaccagttt
ggacagagggaccggtcgtcctccgcccccaacgtccacatcaacaccatcgagccggtc
aacatcgacgacctcctcgggggacagagtcttcagcgctcggacggagcggcgctctcc
gcccgtccctgccgcgccggcgtgcggaggcagcgtacccggacgtgcagccctctcctt
tactccttccccaatgacatagtgtttgatttcgagactgagccagactttggaggttct
acctctggtctttcggcgactcctccggcgtctctgcccgggtccctcaccaacgtcaaa
atgccccagaaatctccctgcccacagagggagcgcaagagctcgtcctcctccgaagac
cgcaataaaatgaaaactttgggtcggcgtgactccagtgacgactgggagatccccgag
ggtcagatcactctgggccaacgcatcggctccgggtccttcggaaccgtcttcaaaggg
aaatggcacggcgacgtcgcggtgaagatgttgaacgtcacagctccaactccacagcag
ctccaggccttcaagaacgaagtgggcgtgctcaggaaaacgcgtcacgtgaacatcctc
ctgttcatgggctacacgaccaaaccgcagctcgccatcgtcacccagtggtgtgagggc
tccagcctgtaccaccacctccacatcatcgagaccaagttcgagatgatcaaactcatc
gacatcgcacggcagacggcgcagggcatggattatttacacgccaagtccatcatccac
cgagacctgaagagcaacaacatctttcttcatgaagacctgactgtgaagatcggagac
ttcggtttggccacagtgaaatctcgctggagcggctctcaccagtttgagcagctctca
ggctccattctgtggatggctccagaggtgatccggctccaggacaaaaacccatacagt
ttccagtcggacgtttacgccttcggcatcgttctgtacgaactcatgtccggagccctg
ccctactccaacatcaacaacagagaccagatcatcttcatggtcggtcgtggatatttg
tctccagacttgagtaaaattcgcagtaactgccccaaagcgatgaagaggctgatggcc
gagtgtctgaagaagaagagggaagagcgccccctatttccacagatcttggcgtcgatt
gagttgttggctcgttctctgccgaagattcaccgttctgcgtcggaaccgtctctgaac
cgcgccgggttccagacggaggacttcagcctgtacgcctgcgcctcgcccaagacgccc
atccaggccggcggctacggggagttctcggcgttcaaataa

DBGET integrated database retrieval system