KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162751Help
Entry
110162751         CDS       T05002                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00010  Glycolysis / Gluconeogenesis
bpec00053  Ascorbate and aldarate metabolism
bpec00071  Fatty acid degradation
bpec00280  Valine, leucine and isoleucine degradation
bpec00310  Lysine degradation
bpec00330  Arginine and proline metabolism
bpec00340  Histidine metabolism
bpec00380  Tryptophan metabolism
bpec00410  beta-Alanine metabolism
bpec00561  Glycerolipid metabolism
bpec00620  Pyruvate metabolism
bpec01100  Metabolic pathways
Module
bpec_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110162751 (aldh2)
   00053 Ascorbate and aldarate metabolism
    110162751 (aldh2)
   00620 Pyruvate metabolism
    110162751 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110162751 (aldh2)
   00561 Glycerolipid metabolism
    110162751 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110162751 (aldh2)
   00310 Lysine degradation
    110162751 (aldh2)
   00330 Arginine and proline metabolism
    110162751 (aldh2)
   00340 Histidine metabolism
    110162751 (aldh2)
   00380 Tryptophan metabolism
    110162751 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110162751 (aldh2)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110162751 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110162751
NCBI-ProteinID: XP_020783309
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MNRVFFSRARPALQRLCVSRFSAPAAAIPTPSTQPEVHYNKLFINNEFQDAVSGRTFPTI
NPSTGEIICQVAEADAADVDKAVQAARRAFRLGSPWRRMDASDRGVLLNRLADAIERNAA
YLAELETLDNGKPYAVAYAVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALFVASLIKEVGFPEGVVNI
LSGMGPSAGAAIAKHMDVDKVAFTGSTEVGHLIQQASGNSNLKKVTLELGGKSPNIILSD
ANMAEAVEQAHFALFFNQGQCCCAGSRTYVQADIYDEFVERSAERAKRRVVGDPFDLRTE
QGPQVDQEQFNKILGYISTGKKEGAKLLCGGGVAADRGYFIQPTVFGDVQDNMTIAREEI
FGPVMQILKFKSLEEVVERANDSIYGLAAAVFTKDLDKAHYISNGLRAGTIWINCYDVFG
AQAPFGGYKASGNGRELGEYGLEAYTEVKTVTIKVPQKN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgtgttcttctcccgcgcgcgccccgcactgcagcgtctgtgcgtcagccgc
ttctccgcacccgccgcggccatcccgacccccagcacccagcccgaggtgcactacaac
aagcttttcatcaacaatgagttccaggacgcggtgagcggacgcaccttccccacgatc
aacccgtccacgggcgagatcatctgtcaggtggcggaggcggacgcggccgatgtggac
aaggcggtgcaggcggcgcggcgagccttcaggctgggctccccgtggcgccgcatggac
gcgtccgaccgcggcgtcctgctcaacagactcgccgacgccatcgagaggaacgccgcc
tacctcgccgagctggagactctggacaacgggaagccgtacgccgtggcctacgccgtg
gacctgcccaacgtcgtcaagtgcctcagatattacgcaggttgggcggacaagtgggag
gggaaaaccatccccatcgatggagattatttctgctacacgagacacgaacctgtggga
gtgtgtggccagatcatcccgtggaacttcccgttgctgatgcaggcgtggaaactgggc
ccggcgctcgccacaggaaacacggtggtgatgaaggtggcggagcagacgccgctcacc
gctctgtttgtggccagtctcatcaaggaggtgggttttcctgagggggtggtgaacatc
ctgtcgggtatgggaccctccgccggagccgccatcgccaaacacatggacgtggacaaa
gtggccttcaccggctccaccgaggtcgggcatctgatccagcaggcgtctggcaacagt
aacctgaagaaagtgactctggagctcggcgggaaaagccccaacatcatcctgtccgac
gccaacatggcggaggcggtggagcaggcgcacttcgctctcttctttaaccagggccag
tgctgctgcgccggctccaggacgtacgtccaggccgacatctacgacgagtttgtggag
cgcagcgcggagcgagccaagaggcgcgtggtgggcgacccgtttgacctgcgcacggag
cagggccctcaggtggatcaggagcagttcaacaagatcctgggctacatcagcactggg
aagaaggagggggcaaagctgctctgcggggggggcgtggcagccgaccgaggatacttc
atccagcccacagtgttcggagacgtccaggacaacatgaccatcgcccgggaggagatc
tttggtccagtgatgcagatcctgaagtttaaatccttggaggaggtggtcgaacgcgcc
aatgactccatatacggcctggcagctgccgtcttcaccaaagacctcgacaaagcccat
tacatctccaacggactccgcgctgggactatctggattaactgctatgacgtgttcggg
gcgcaggctccgtttggagggtacaaggcgtcagggaacgggcgagagctcggcgagtac
ggcctggaggcgtacaccgaggtcaagacggtcaccatcaaggttccccagaagaac

DBGET integrated database retrieval system