KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162903Help
Entry
110162903         CDS       T05002                                 

Gene name
hdac2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04110  Cell cycle
bpec04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110162903 (hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110162903 (hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bpec03036]
    110162903 (hdac2)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110162903 (hdac2)
Chromosome and associated proteins [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110162903 (hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     110162903 (hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110162903 (hdac2)
  Chromatin remodeling factors
   NuRD complex
    110162903 (hdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110162903
NCBI-ProteinID: XP_020783509
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MAYTTAGGTKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHK
ATAEEMTKYHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSSGGSA
AGSVKLNRQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIH
HGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDESYE
QIFKPVMAKVMEMYQPSAIVLQCGADSLSGDRLGCFNLTIRGHAKCVEYMKSFNLPLLML
GGGGYTIRNVARCWTYETAVALDTEIPDELPYNDYFEYFGPDFKLHISPSNMTNQNTQEY
MDKIKQRLFENLRMLPHAPGVQMQAIPEDAVPEDTVDEDKEDPDKRLSIRATDKRIACDE
EFSDSEDEGEGGRRNIANNKKGAKRPRVEEDKKEGDEKKTEIKEEDKSKDIGAEKTDSKS
VKAEQTSSA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcatacacgactgccggggggaccaagaagaaggtgtgctactactatgacggtgac
attggaaattattactatggccaaggacatccgatgaagccacatcgcatcagaatgaca
cacaaccttctcctgaactatggactgtacaggaaaatggagatctatagaccacacaaa
gccactgcagaagaaatgaccaagtaccacagtgacgattacatcaagttcctccgatca
ataaggcctgacaacatgtccgagtttagcaagcagatgcagagattcaatgtgggagaa
gactgtcctgtatttgatggcctgtttgagttctgtcagctttcttctggaggctctgct
gctggctcagtgaagctgaacagacagcagactgacattgcagtaaactgggctggaggt
cttcaccatgctaagaaatcagaggcgtctggcttctgctacgtcaatgacatcgtgttg
gcaatcctggagctgctcaagtaccaccagagggtgctgtacatagacatcgacatccac
catggcgatggggtggaagaggccttttacaccacagatcgggtcatgactgtgtccttc
cataaatacggagagtacttccccggaactggagacctcagggatattggagctgggaaa
ggcaaatattatgctgtcaactttcctctgcgagatggcattgatgatgagtcatatgaa
caaatcttcaaaccagtaatggccaaagtgatggagatgtaccagcccagtgccattgtt
cttcagtgtggagcagactctttgtctggggaccgacttggctgctttaacctgaccatc
cgaggacatgccaagtgtgtggagtacatgaagtcctttaacctgcctctgctgatgctg
ggaggaggggggtacaccatccgaaacgtggcccgctgctggacctatgaaacagctgtg
gcactggacacagagatccctgatgaactaccatacaatgactattttgaatactttgga
ccagatttcaaactgcacatcagcccatccaacatgaccaaccagaacacgcaggagtac
atggacaaaataaagcagcgcctctttgagaacctgcgcatgttgcctcatgctccaggg
gtgcagatgcaggccatcccagaggacgctgtcccagaagacacagtggacgaggataaa
gaggacccagacaaacgcctctccattcgggccacagacaagaggattgcctgtgatgaa
gagttttcagactctgaggatgaaggagagggaggcaggaggaacatagccaacaataag
aagggagccaagcggccgcgagtggaagaggacaagaaggaaggcgacgaaaagaagacc
gaaattaaagaggaagacaagtcgaaagacattggtgctgaaaaaacagattctaaaagt
gtgaaagcagagcagaccagcagtgcctga

DBGET integrated database retrieval system