KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162910
Entry
110162910         CDS       T05002                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110162910
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110162910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bpec04052]
    110162910
   00536 Glycosaminoglycan binding proteins [BR:bpec00536]
    110162910
Cytokines and growth factors [BR:bpec04052]
 Growth factors
  Growth factors (RTK binding)
   110162910
Glycosaminoglycan binding proteins [BR:bpec00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110162910
SSDB
Motif
Pfam: FGF Fascin Ntox17
Other DBs
NCBI-GeneID: 110162910
NCBI-ProteinID: XP_020783484
LinkDB
Position
Unknown
AA seq 158 aa
MMDGDAAEHKTEQRADLSAFLPDYRSLTRLYCMNGGHHLQLLPDGTVQGQRDDGDVHTFL
KLKAVDIGVVVIFGKEAGMYLAMNSEGRLYSCPTVSEECHFLEKLEENHYNTYQSKKFKE
MNWYVGLKKNGKPKLGPRTHIGQKAIFFLPRQVHDSET
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatggacggagacgcagcggagcacaagactgagcagagggcggacttaagtgccttt
ttgccagactacaggagtctcacccggctgtactgcatgaatggcggacatcacctccag
ctcctccccgatgggacagtgcagggccagagggacgatggggacgtacacacctttttg
aagcttaaagctgtggacattggtgttgtggtcatatttgggaaggaagctggaatgtac
cttgccatgaacagcgagggtcgtttgtacagctgtccaacagtaagtgaggaatgtcat
ttcctggagaagctagaagaaaaccattacaacacatatcagtccaaaaaatttaaagag
atgaattggtatgtgggtttgaaaaagaacggaaaacctaaattgggcccaagaacccac
ataggacagaaagccatcttctttctccccagacaagtgcacgattcagagacctga

DBGET integrated database retrieval system