KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162936
Entry
110162936         CDS       T05002                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04060  Cytokine-cytokine receptor interaction
bpec04068  FoxO signaling pathway
bpec04144  Endocytosis
bpec04218  Cellular senescence
bpec04350  TGF-beta signaling pathway
bpec04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110162936
   04350 TGF-beta signaling pathway
    110162936
   04068 FoxO signaling pathway
    110162936
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110162936
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110162936
  09143 Cell growth and death
   04218 Cellular senescence
    110162936
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110162936
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110162936
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110162936
Protein kinases [BR:bpec01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110162936
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 110162936
NCBI-ProteinID: XP_020783510
LinkDB
Position
Unknown
AA seq 560 aa
MVRCKTSRVGILVLLSLCLFAVEGFTHLSFNVCRWCEVSSPICRDSVCVSNCSLSSFCSS
TEEICIAIWRKSNETMTVQTMCHHPAVPLEGVDQAVLLNVSSRECHMVSQPTAEGAMMVC
GCKGEHECNDRLIFDKGANGFSKLQSKEVIPVVLVSLVPPVLVALVASMAFYIYRTRRFG
KPGPPARPEWPAKPPHELYQALDPPCGRQAECGESVTNSLQQIEDSNAKIPVINNGIRDV
IEWQGKLTTPLPIKLETLVGKGRFAEVWKGRLVQSDKTNSHETVAVKVFPAMEYASWRNE
CSIFSDPKVQHENIVTFLAAEERGGPGHAHRKYWLVLAYHSLGNLQEFLTENTLNWEELI
SMGSSVAKGLAHLHSDTTPTGVPKVPIAHRDLKSSNIVVKSRQDCALCDFGLALRLDMSL
TVDDYANSGQVGTARYMAPEVLESRVNLEDLEAFKQIDVYSMALVLWEMGSRCQAIGEVK
SYEPAFGSKVCDQPCVDSMRDLVLRDRGRPEIPTTWTQHQGMSVFCSTITECWDHDPEAR
LTAHCVVERFIAIQNEEETE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggttcggtgcaagacatcccgggttggaatcctggttttactaagtctgtgcttgttt
gcggtggagggcttcactcacctgagcttcaacgtgtgtcgctggtgtgaagtgtccagt
ccgatctgcagagacagtgtgtgtgtgagcaactgcagcctgtcctccttctgctccagc
accgaggagatctgcatcgcaatatggaggaaatccaacgagaccatgactgtgcagacc
atgtgtcatcacccggctgtgccactagagggcgtggaccaagccgtgctcctgaatgtc
agctccagagaatgtcacatggtttctcagccaacagcagagggcgctatgatggtctgc
ggctgcaaaggagagcacgaatgcaacgacagactcatctttgataaaggagccaatggt
ttctcaaagctgcagagtaaagaggtgatccccgtggtcctggtgagcctggtgcctcct
gttttagtagctttagtcgcttccatggccttttacatctaccgcactcgccgctttggc
aaaccgggccctccagcgcgccccgagtggcccgccaaacccccccacgagctgtatcaa
gccctggaccctccctgtggacgccaagcagagtgtggggaaagcgtcaccaattcttta
caacagatcgaagactccaatgcaaaaataccagttatcaacaacggtattagagatgtt
atcgaatggcaaggaaagctgacgacgcctctaccgattaaactggagactttggttgga
aaaggtcgatttgcagaagtgtggaaaggtcgattggttcaaagcgacaaaacgaattct
cacgaaacggtagctgtcaaagttttccccgccatggagtacgcgtcatggagaaacgaa
tgttcgattttctcagatccaaaagtccagcatgaaaatatagtgacttttttggctgcg
gaggaaaggggcgggccaggacacgcccacaggaagtactggctggttctggcctatcac
agtcttggaaatctgcaggagtttctgactgagaatacactaaactgggaggagctgata
tcgatgggcagcagcgttgcgaaagggttagcgcatcttcacagtgatactacgccaaca
ggggtccccaaggtgcccatcgcccacagagacctgaagagcagtaatattgtggtgaag
agcagacaggactgcgctctgtgtgacttcggtttggctttgagactggacatgtccctc
accgtggacgactatgccaacagtggacaggttggcacggcacggtacatggctcctgag
gttctggagtcccgggtgaacctggaggacctggaggcgttcaaacagatcgatgtttac
tctatggctctggtgctgtgggagatgggctcacgctgccaggccatcggagaggtgaag
agctacgagcctgcgtttgggtccaaagtgtgcgatcagccgtgtgtggacagtatgaga
gacctggttctgagagacagaggaagaccggagattcccacaacctggacacagcaccag
ggcatgagtgtattctgctccaccatcaccgaatgctgggaccacgaccccgaagcgcgt
ctcactgctcactgtgtggtcgaacgattcattgcaatacaaaatgaggaggaaacagag

DBGET integrated database retrieval system