KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110163362
Entry
110163362         CDS       T05002                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110163362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpec03000]
    110163362
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bpec03310]
    110163362
Transcription factors [BR:bpec03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110163362
Nuclear receptors [BR:bpec03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   110163362
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110163362
NCBI-ProteinID: XP_020783971
LinkDB
Position
Unknown
AA seq 752 aa
MDKGGVKKLVYRRDDHLSKLVYTESSEERGLLRVVPPSAMSIASATSIVLPPSPLMQPGQ
VPNGFNNSPLSESLSSSSVIASVGSGDQEPRGLTKDQKNLLGSRVQDSAQSSMDSLIGGS
DPNFFPLKTDFSMDKGEPDPIDLDHDFDHISKDMDVNQKLFCDNTLDLLQDFELTGSPSD
FYVGDDAFLSTLGEDSLLGDVSSDRDTKPTLVESSNNCGTVTLNGSNITSPSQTSASTST
PSPLTPSSSLSISVKKEKDCGLIQLSTPGVIKQEKTSLGQNYCQISGTSSTNLPRSNPIS
ICGVSTSGGQSFHFGVSNETQQQKDQKPVTTLYLPVTTVSGSWNRVQGNGDTSGIHRGNE
SFSSASLTFTSSSTRKESSSAPTSAQGKNNAHKVCLVCSDEASGCHYGVLTCGSCKVFFK
RAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEARKIKKNRLKGVQQSNV
SEAIQPSPPVEPRPLVPKCMPQLVPTMLSLLKAIEPETIYAGYDSTLPDTSTRLMTTLNR
LGGRQVISAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGDMLCFAP
DLVINEDRMKLPFMTDQFEQMLKISSEFVRLQVSHDEYLCMKVLLLLSTVPKDGLKSQAV
FDELRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHEMVGGLLNFCFYTFVNKSL
SVEFPEMLAEIISNQLPKFKAGSVKALLFHQR
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggacaaaggaggagtaaagaagttggtctacagaagagatgaccatttgagtaaactg
gtctacacagagagctccgaggagagaggcctgttgagagtggttcctcccagtgccatg
tccatcgcctctgccacctctatagtacttcctccaagccccttaatgcagccaggacag
gtcccaaacggcttcaacaacagccccctttcagaaagcctttcctcttcttcagtcatt
gcttcagtaggctcaggtgaccaagagcccagaggcctaaccaaagatcagaaaaatctg
ttaggatccagagtccaggacagtgcccagtcctccatggattccctcataggagggtca
gatccaaactttttccccctgaaaacggacttctctatggataaaggagaaccagatccc
attgaccttgaccatgattttgaccatatcagcaaagatatggatgtgaaccagaagttg
ttctgtgataacactctggatctccttcaggactttgagctcactgggtccccgtcagat
ttttatgttggtgatgatgctttcctctcaactttgggggaagactctttgcttggagat
gtcagctctgacagagacactaagccgacccttgttgagagcagcaataactgtggcaca
gttactcttaatggcagtaacatcactagtcccagtcagacgagtgctagcacatccaca
ccttcccctctaacaccttcatccagtttgtctatttcagtgaagaaagagaaagactgt
gggctcattcagctgagcacccctggggtgataaagcaggagaagacatctttaggccag
aattattgccaaattagtggcacatcttccaccaatctgcccaggtctaaccctatttcc
atctgtggtgtgagcacgtcaggaggacagagctttcattttggagtgagcaatgaaacg
cagcagcaaaaagatcaaaagcctgtgactacactgtacctcccagtgacaacagtcagc
ggttcttggaacagggtccagggaaatggcgacacttcgggcatccacagaggaaatgag
agtttctccagcgcttctctgacttttaccagttcttccactcgtaaggagagcagcagc
gctccgacctcggcacaaggcaaaaacaatgctcataaagtctgcctggtgtgttctgat
gaagcatcaggctgtcactatggcgttctcacctgcggcagctgcaaggtcttttttaag
agggcggttgaagggcaacataattacctatgtgctggcagaaatgactgcatcattgac
aaaatcaggaggaagaactgccccgcttgccgttttcgcaagtgtcttatggctggcatg
aacctggaagctcgtaaaatcaagaagaaccgtttaaaaggtgtgcagcagagcaacgtg
tccgaagcgattcagccttctccacctgttgagccccgcccccttgtgcccaaatgtatg
ccccagcttgtgcccaccatgctgtccctgttgaaagctatcgagcctgagaccatatac
gcgggctatgacagcacactgcctgacacgtccactcgcctaatgaccacattgaacaga
ctggggggcagacaggtcatctcagctgtcaagtgggccaagtccctgccaggattcagg
aacttgcatcttgatgatcaaatgaccctactgcagtgctcctggctctttctcatgtcc
tttggtttgggatggaggtcctatcagcagtgtaatggcgacatgctctgctttgctcca
gatcttgtcattaatgaggacagaatgaagctgccattcatgactgaccagtttgaacag
atgctgaagatttccagcgagtttgttcgtctgcaggtctctcatgatgagtacttgtgc
atgaaggtcctgctgctgctcagcacagtgccaaaggacggcctaaagagccaggctgtg
tttgatgagcttcggatgtcctacattaaggagctggggaaagcaatagtaaaaagagag
gaaaactccagtcagaactggcaacgcttctatcagctcaccaagcttctggattccatg
catgagatggttggtggactcctcaatttctgcttctacacatttgtgaacaagtccttg
agtgtggagttcccagagatgttggctgagatcatcagcaaccagttaccaaaattcaaa
gctgggagtgtgaaagcgctcctgttccaccagagatga

DBGET integrated database retrieval system