KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110163422Help
Entry
110163422         CDS       T05002                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00512  Mucin type O-glycan biosynthesis
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    110163422 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bpec01003]
    110163422 (galnt9)
Enzymes [BR:bpec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     110163422 (galnt9)
Glycosyltransferases [BR:bpec01003]
 O-Glycan biosynthesis
  Mucin-type
   110163422 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 110163422
NCBI-ProteinID: XP_020784036
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELIQLGRLTDQRLRGRNGKVSNLVD
RQSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSRDAEGKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQLTYPEDLPQISVVFIFVNEALSVILRSVHSVVNHTP
AHLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAA
VVGFFDAHVEFNTGWAEPILTRMKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGQIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNIP
MNNPGVDFGDVSERLALRKKLQCRSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEDDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLIDDGRGRTPSLKK
CEAVSRSSQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaaaatcaaaactttactgacagtgaatattttagtctttgttggg
attatattattttcggtctactgcaggatacaggaccgatccgaggagctgattcagtta
gggaggcttactgaccagaggctacggggaagaaatggcaaagtttccaacttggtagac
agacagtccattctgcagaggctggagaggctggaggatgttgtctacaatcagctcaat
ggtctggccaagcccatggggttggtggagggtcccggaggtttggggcaaggtggagct
gctgccactctgggggaagacagtcgtgacgcggagggcaagtacgaggagtatgggtac
aacgctcaactcagcgaccgcatctctctggacaggagcattcccgactacaggcccaag
aagtgtaagcagctgacgtaccccgaggacctgcctcagatctccgtggtgttcatcttt
gtgaatgaggctctgtctgtgattctgcgctccgtccacagtgtcgtcaaccacacacct
gctcacctgctcaaagagatcatcctggtcgatgacaacagtgacagtgttgagctgaag
ttcaacctggaccagtacgtgaacaagcgttacccgggtttggtgaagattgtgaggaat
agcaaacgtgagggtctgatcagggctaggatccatggctggaatgctgctacagctgct
gtagtcggcttcttcgatgctcacgttgagttcaacaccggctgggctgaacctatcctg
acccgaatgaaggaagaccacacacgcatcatcctgcccgccatcgacaacatcaaatac
aacacatttgaggtccagcagtacgccaacgccgcccacggctacaactggggcctgtgg
tgcatgtacatcatacccccacaggagtggctggacaagggcgatgagactgcccccatc
agaactcctgctatgatcggctgctcttttgtggtggatcgggaatactttgggcagatc
ggactactggaccccgggatggaggtgtacggcggagagaacatcgagctagggatgagg
gtgtggcagtgtggaggcagtatggaggtcctgccctgtgcccgagtggcccacatcgaa
cgcacgaagaagccctacaacaatgacatcgattactacgccaaacgcaacgccctgaga
gctgccgaggtgtggatggatgaatacaaatctcacgtctacatggcctggaacattccc
atgaacaacccaggtgtggatttcggagatgtgtcagagcgcctggccctgaggaagaag
ctgcagtgtcggagtttccgctggtacctggaacacgtctaccccgagatgagaatctac
aacaacactatcacatacggagaggtgaggaacagcaaagccagtgggtactgtctggat
caaggctcagaggatgatgacaaagcaatcctctacccctgccatgggatgtcatcacag
ttggcgcggtactccactgagggcctcctgcagttggggcccctgggctccaccaccttc
ctccctgataccaaatgtttgattgacgacggcagaggacgaacccccagtctcaagaag
tgtgaggccgtgtccaggagctcacagcgcctctgggacttcacacagaacggccccatc
atcagcagggacactggccggtgcttggaggtggaaatgtccaaagacgccaacttcggc
ctgcgcctggtggtccaacgctgttcaggccagaagtggatgatccgaaactggattaaa
cacccacggcactga

DBGET integrated database retrieval system