KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110163737Help
Entry
110163737         CDS       T05002                                 

Definition
(RefSeq) zinc finger and BTB domain-containing protein 16-A-like
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bpec04121]
    110163737
Ubiquitin system [BR:bpec04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110163737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 BTB zf-C2H2 zf-C2H2_jaz zf-C2H2_6 zf-met zf-C2H2_8 zf-C2H2_2
Motif
Other DBs
NCBI-GeneID: 110163737
NCBI-ProteinID: XP_020784407
LinkDB All DBs
Position
Unknown
AA seq 556 aa AA seqDB search
MGVLQLHNPSHSSTLLHRANQMRLTGTLCDVIITVDGQEFPAHRTVLACTSKMFEILFHR
SSLRYALDFLSPKTFQQILEYAYTASLQATAEDLDDLLYAAEILEIEYLEEQCLKVLETI
QHEESHDVALKNHSPTDHGEPRARHWRQMLMSKKHSIQDGPARTTPSVLHQLALYHMSDR
SPTHMEQNNTPLSPKQLQEGALKSTHESPSELSQVTSMDPDSIKCESMQVDEPEVGQGQP
SSPDQGSGVAEQSHDEGPGTPLRSSVITSARELHSSPEHGGAASQSQCCGECGLQLHSRQ
AMEQHRRLHSEEKGHGCEFCGKHFQDSMRLRMHMLSHTAPAEALVCDQCAATFSSEDALE
AHRQTHTGTDMAVFCLLCAKRFQTQKALQQHMEVHTGMHSYICSHCERPFPSHTTLKRHL
RSHTGDHPFECEFCGSCFRDDGTLRGHKRIHTGEKPYECNGCGKRFSLKHQLETHYRVHT
GEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICQDFCPSLAAMQKHMKGHNPEEV
PPDWRIEKTYLYVCYV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgctccagctccacaatccttctcactccagcactttgctgcatcgggccaat
caaatgcgtcttactggcaccctatgcgatgtcatcatcacagtggatggccaggagttc
ccagcacatcgcacagtcctggcctgcaccagcaagatgtttgagatcctgttccatcgc
agcagtctgcgatatgccctggacttcctgtcccctaagaccttccagcaaatcctggag
tatgcttacaccgcctctctgcaagccactgctgaggacctagatgatctgctgtatgct
gcagagatcctggagatagagtatctggaggagcagtgcctcaaggtgctggagaccatt
cagcatgaggagagccatgatgtagccctgaaaaaccacagccccacagaccacggcgag
ccacgcgcccgccactggagacaaatgctaatgtcaaagaagcattccatacaggatggg
cctgcacgcaccaccccctctgtcctgcaccagctggccctgtaccacatgtctgacaga
agtcccactcacatggagcaaaacaacacaccgctgagcccaaaacagctccaggagggg
gcgctgaagagcacccatgagtcgccctcagagctgtcccaggtgacctctatggatcct
gacagcatcaagtgtgagagcatgcaagtggatgagcctgaggtgggccaaggccagccc
tccagcccggaccaggggagcggtgtcgcagagcagtctcatgatgaggggcccgggacc
cccctgagaagcagcgtcatcaccagtgctcgagagctgcactccagccctgagcatgga
ggagcagcgagccagagccagtgctgtggtgaatgtgggctacagctgcacagccgccag
gccatggagcagcacaggaggctgcactctgaggagaagggccacggctgtgagttctgc
ggtaaacactttcaggacagcatgaggctcaggatgcacatgttgtctcatacagctcct
gccgaagcgctagtttgtgatcagtgtgcggctacattctcttctgaagatgccctggaa
gctcatcgacaaacgcacacagggactgacatggcggtgttctgtctgctgtgtgcaaag
cgcttccagactcagaaggccctgcagcagcacatggaggtccacacaggcatgcacagc
tacatctgcagccactgtgagcggcccttccccagccacaccacgctcaaaagacatttg
cgctcacacacaggagaccacccctttgagtgtgagttctgtgggagctgcttcagagat
gacggcacactgaggggccacaagcgcatccacactggagagaagccttatgagtgcaat
ggctgtggcaagaggttcagcctcaaacaccagctagagacgcactaccgcgtgcacaca
ggggagaagccatttgagtgtaagttatgtcatcaacgctcaagagactattcagcgatg
atcaagcacctgcgcactcacaatggagcgtctccataccagtgcaccatctgccaggac
ttctgcccgagcctggccgccatgcagaagcacatgaagggtcacaaccctgaggaggta
ccccccgactggaggatagagaagacttacctgtacgtctgttatgtctaa

DBGET integrated database retrieval system