KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110163752Help
Entry
110163752         CDS       T05002                                 

Gene name
wbscr17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00512  Mucin type O-glycan biosynthesis
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    110163752 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bpec01003]
    110163752 (wbscr17)
Enzymes [BR:bpec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     110163752 (wbscr17)
Glycosyltransferases [BR:bpec01003]
 O-Glycan biosynthesis
  Mucin-type
   110163752 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 110163752
NCBI-ProteinID: XP_020784421
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MAVVLRRWRVLLVLNVLAVGVFITFWTTCNTRTFLASDLDTGAEGKRLKGNGTTSDSEIS
HDLLLNRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPSTLSPLEEIDAKPLRDKYG
YNAYLSDRISLDRSLPDHRPSQCKTLNYPRDLPQISLIFIFVDEALSVILRSVHSAVNYT
PAHLLKEIILVDDNSEDEQLKAPLEEYVNKRYPGLVKIVRNQKREGLIRARNEGWKVATG
EVTGFFDAHVEFTPYWAEPVLARIKDDRRRIILPSIDNIKHDTFELERYENSGHGYNWEL
WCMYISPPKQWWDEGDMTAPIRSPAMIGCSFVANRDYFGELGLLDSGMDVYGGENIELGI
RVWLCGGSMEVLPCSRVAHIARSKKPYHNNIAFHTRRNALRVAEVWMDKYKSNVYLAWNI
PMENHGIDIGDISERVALRERLQCKNFEWYLDNVYPEMRKYSNTVFYGEMRNSEASHLCM
DQGLKENHTVTLHPCHGWGPQLGRFTKEGQLFLGALGSTGDDTRCVVDDQTSSVPQLLNC
DKVTNLKQKTWNFSQNSSVINQASGRCLEVVPAKVYFGHQLVLQSCRGQRWTIKNTMKQT
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgtgttaagacgatggagagtcttactggtgctgaacgtacttgcggtcggt
gtcttcataacattttggaccacatgcaacacaagaactttcctggccagtgatctggac
actggggctgaggggaagaggttaaagggcaatggaaccacgtcagactctgaaatcagc
catgacctgctcctaaacaggctcagctcacttgaggatgtggtgtataggcagctcaat
ggactatccaaatctctaggtctgattgagggctttggaggtcgggggaaaggtggactt
ccttccactctgtctccattggaggagattgatgccaaaccgctgagggacaagtacggc
tacaacgcctacctcagtgaccggatctccctggaccgcagcctcccagatcaccggccc
agtcaatgtaaaacacttaactaccccagagatctacctcagatctctcttatctttatc
tttgtggacgaggccctgtcagtgattctgcgctccgttcattcagccgtcaactacacg
ccggcccatttgctcaaagagattatacttgtggatgacaacagcgaggatgaacagctg
aaggctccattggaggagtatgtgaacaagcggtatccaggtctggtgaaaatagtgagg
aaccagaagagagagggtttaatccgtgccagaaacgaaggttggaaagtggccactgga
gaggtgactggcttctttgatgctcatgtggagttcaccccatactgggctgagccagtt
ctggcccgaatcaaagatgaccgcaggaggattatcttgccatccatcgacaacatcaaa
catgacacgtttgagctggagcgctatgaaaactctggccacgggtacaactgggagctt
tggtgcatgtacatcagccctcccaaacagtggtgggatgagggggacatgactgctcct
atcaggagtcccgctatgattggctgctcttttgttgctaaccgagactactttggtgag
cttggcctgctggactctggcatggacgtctatggaggagagaacattgagttgggcatc
agggtttggctgtgtgggggcagtatggaggtgctaccctgctccagagttgcccacatt
gcccgatcgaagaaaccctatcacaataacattgcatttcacacaagacgcaatgctctc
cgggttgcagaggtctggatggacaaatacaagtccaatgtctacctggcctggaatata
cccatggagaaccatggcattgatattggagacatttctgagagagttgcactaagagaa
cgactacagtgtaaaaactttgagtggtacctggataatgtgtaccctgagatgaggaag
tacagcaacacagtgttctatggagagatgcgtaactctgaagccagccacctgtgcatg
gaccaaggtttaaaggagaaccacacagtgacactgcacccctgtcatggctggggtcct
cagttaggacgttttaccaaagaggggcagttgttcctgggagctctgggcagtacaggt
gatgacacccgctgtgtggtagatgatcaaaccagcagcgttcctcagctcctcaactgt
gacaaagtgaccaacctcaagcagaagacatggaacttctcacagaattcttcagtgata
aaccaggcgtctgggcgctgtcttgaggtggtgccggctaaagtgtattttggacaccag
ctggtcctacagtcgtgcagaggacaaagatggaccatcaaaaacaccatgaaacagaca
tga

DBGET integrated database retrieval system