KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110163897
Entry
110163897         CDS       T05002                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110163897 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bpec04052]
    110163897 (epo)
Cytokines and growth factors [BR:bpec04052]
 Cytokines
  CSF and other factors
   110163897 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 110163897
NCBI-ProteinID: XP_020784569
LinkDB
Position
Unknown
AA seq 193 aa
MLDLSNLIGPSNSIRLLTLLLMLLELSRPALPSPLKPICDLRVLNHFIKEARDAEAAMKV
CREGCLLSEALTVPQTRVDFEVWENKNASEQALEVQSGLWLLQQALNLLRTSVTNTQLHS
HIDSCISNLLSLSAVLRSLNLQEYSPPTSTVGLEGTWTVSSPTELLQVHLNFLRGKVRLL
LLSAQACQQHDVS
NT seq 582 nt   +upstreamnt  +downstreamnt
atgctggatctctcgaatttgattggcccctctaactcgatcagactgctcaccctgctg
ctgatgctgttggaattgtccagacccgccctaccgtcccctctgaagcccatctgtgac
ctcagggtcctcaaccacttcatcaaggaggcacgagacgccgaagccgctatgaaagtg
tgtcgagaaggatgtcttctgtctgaggctctcactgttcctcaaaccagagttgacttt
gaagtctgggaaaataaaaatgcatcagagcaggccctggaggtgcagtctggattatgg
ctgttgcagcaggccttgaatctcctgcgcacatccgtcactaacacacagctgcacagc
cacatcgactcttgtatcagcaacctgctgagcctcagcgctgtgctgcggagtctgaac
ctccaggaatatagtccgcctacaagtaccgtgggactcgagggaacgtggacagtttca
tcaccaacagaacttctacaagttcacttgaactttttgcgtggaaaggtgcgcctgcta
ttgctcagcgcacaggcgtgtcaacaacatgatgtcagctga

DBGET integrated database retrieval system