KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110164085Help
Entry
110164085         CDS       T05002                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00500  Starch and sucrose metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110164085
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     110164085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 110164085
NCBI-ProteinID: XP_020784763
LinkDB All DBs
Position
Unknown
AA seq 512 aa AA seqDB search
MKWLILVALFGLSAAYHNPHMKHGRTSIVHLFEWRWADIAAECERYLGPNGFGGVQISPP
NEHIIINNPWRPWWQRYQPIGYNLCSRSGNEHELRDMITRCNNVGVNIYVDAVINHMCGA
GGGEGTHSSCGSWFSANRKDFPSIPFTGWDFNDHKCRTGSGNIENYGDANQVRDCRLVGL
LDLALEKDYVRGKVADFMNKLIDMGVAGFRVDACKHMWPGDLQNVYGRLHNLNTKWFSSG
SRPFIYQEVIDLGGEPITSREYFHLGRITEFKYGARLGTLFRKWNGEKLSYTKNWGEGWG
FMPNGNALVFVDNHDNQRGHGAGGASIVTFWDSRLYKMAVGYMLAHPYGVTRVMSSFRWD
RHFVNGKDQNDWMGPPSHGDGSTKSVPINADQTCGDGWVCEHRWRQIKNMVKFRNVVNGQ
PHSNWWDNQSNQVAFGRGNRGFIVFNNDDWNLDMTLNTGMPGGTYCDVISGQKENGRCTG
KQIHVGGDGRAHFKISNRDEDPFVAIHAESKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgattttggtggctctttttgggctgagtgcagcttatcacaaccctcac
atgaagcatggacgcacctccattgtgcacctgttcgagtggaggtgggccgacatcgcg
gcagagtgtgagcgctacctcgggcccaatggcttcggaggtgttcagatctcccctccc
aatgagcacatcatcatcaacaacccctggaggccctggtggcagcgttatcagccaatc
ggatacaacctctgctcccgatcaggaaatgagcatgagctccgcgacatgatcaccaga
tgcaacaacgtcggggtgaacatctatgtggatgctgtgatcaaccacatgtgcggtgct
ggaggtggagagggcacccactcctcctgcggcagctggttcagtgccaacagaaaggac
ttcccctccatccccttcactggctgggacttcaatgaccacaagtgcaggactggcagc
ggcaacattgagaactatggagatgccaatcaggtccgtgactgccgtctggtgggtctg
ctggatcttgctctggagaaggactacgtcaggggtaaagtggcggacttcatgaataag
ctgattgacatgggcgtggctgggttcagagtggatgcctgtaaacacatgtggcctgga
gacctgcagaatgtgtacggacgcctccacaacctcaacaccaagtggttctccagtgga
tccagacctttcatctaccaggaggtcattgatctgggaggcgagcctatcacctccagg
gagtacttccacctgggacgcatcactgagttcaaatatggcgccagactgggaactttg
tttaggaagtggaatggagagaaactcagctacaccaagaactggggagagggctggggt
ttcatgcccaatggaaacgccttggtgttcgtggataaccatgacaatcagagaggtcac
ggagcgggtggagcgtccatcgtcactttctgggattccagactgtacaagatggccgtc
gggtacatgctggcccacccctacggagtcaccagagtcatgtccagcttcagatgggac
cgtcactttgtcaatggaaaagatcagaatgactggatgggacctcccagccatggagat
ggatctaccaaatctgttcccatcaacgctgaccagacctgtggagatggctgggtgtgt
gagcacagatggaggcagatcaagaacatggtgaagttccgtaatgtggtgaatggacag
cctcactcaaactggtgggacaaccagagcaaccaggtcgcctttggacgtggcaaccgc
ggattcatcgtcttcaacaatgacgactggaaccttgacatgaccctgaacactggcatg
cccggaggaacatactgtgacgtgatctcaggtcagaaggagaacggcaggtgcacaggc
aaacagatccatgtgggaggagacggtcgcgcccacttcaaaatcagcaaccgcgacgag
gacccatttgtggccattcatgccgagtccaagttgtga

DBGET integrated database retrieval system