KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110164974
Entry
110164974         CDS       T05002                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04012  ErbB signaling pathway
bpec04068  FoxO signaling pathway
bpec04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110164974
   04068 FoxO signaling pathway
    110164974
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110164974
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110164974
NCBI-ProteinID: XP_020785782
LinkDB
Position
Unknown
AA seq 173 aa
MCIKMSDVRLSNASPTLERVDARLPDSIRPSVRRCLFGTPDREELRETYNEFKQAEERRF
RDTYNFDPVEDRPLSPGKYKWEVDENAPEFYRRPPHRRENRGRSSPRDQVETTPGQTAET
ERSRKRPSDPSGSSCSSEPHSKSSRSNGEHEGDQPDHGTSRAAQVPEQAPEDQ
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtgcataaaaatgtcagatgttcgcctttctaatgcgagtccgaccttggagagggtg
gatgcgcggctgccggacagtattcggccatcggtgcgcagatgccttttcggcacacct
gaccgagaggagctgcgggagacttataatgaatttaagcaggcggaggagcgccgcttc
agggacacctataacttcgaccccgtagaggatagaccactttctcccggaaagtataag
tgggaggtagacgagaacgcgccggagttttaccgcagacctcctcacaggagagagaac
cgcggcaggagcagcccgcgggaccaagtggagacaacaccggggcaaacggcagagacc
gagcgctccaggaaacgaccatcagacccctcaggatccagctgcagcagcgagccgcac
agtaagagctcgcgctctaacggggagcacgagggcgaccagccggaccacgggaccagc
cgagcggcgcaggtcccagagcaggcgcccgaggaccagtga

DBGET integrated database retrieval system