KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166052Help
Entry
110166052         CDS       T05002                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00562  Inositol phosphate metabolism
bpec01100  Metabolic pathways
bpec04068  FoxO signaling pathway
bpec04070  Phosphatidylinositol signaling system
bpec04115  p53 signaling pathway
bpec04140  Autophagy - animal
bpec04150  mTOR signaling pathway
bpec04218  Cellular senescence
bpec04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110166052
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110166052
   04070 Phosphatidylinositol signaling system
    110166052
   04150 mTOR signaling pathway
    110166052
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110166052
  09143 Cell growth and death
   04115 p53 signaling pathway
    110166052
   04218 Cellular senescence
    110166052
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110166052
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bpec01009]
    110166052
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110166052
    3.1.3.48  protein-tyrosine-phosphatase
     110166052
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110166052
Protein phosphatases and associated proteins [BR:bpec01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110166052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 SelK_SelG PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 110166052
NCBI-ProteinID: XP_020786911
LinkDB All DBs
Position
Unknown
AA seq 414 aa AA seqDB search
MANIIKEIVSRNKRRYQLGDFDLDLTYIYPNLIAMGFPAERLEGVYRNNIDDVVRFFNSR
HKNNYKIYNLCSERNYDPNKFNCQVAQYPFDDHSPPQLELMRLFCEDLDSWLGQDAKHVA
AVHCKAGKGRTGVMICAYLLHRGQFTTPEDVLEFYGQARTTDRKGVTIPSQRRYVSYYSV
LLKNRLQYKPTALLLHKVLFHTVPMFTNGTCNPQFVVFQLKVKLFTSNSALTKREDKHLQ
MDLPQPLPLCGDVKVEFYHKTSKITKKEKMFHFWFNTFFVPEPPPNGQNHENGGSQQNRK
RGGGGEEERGEERGGGAEEQSGPDFLTLSLCKQELDKANKDQSHRNFSPNFRVELFFTKP
QEDGAGSDSASSVTPDASDAELDQYHYSDTTDSDQDQDSDPEPDLDQDYQVSRV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacatcatcaaggagatcgttagtcggaacaaaaggcggtaccagctcggagac
ttcgacctggacctcacctatatttacccaaacctgatcgcgatgggcttccctgccgag
cgtctggagggagtttacaggaacaacatcgacgacgtcgtacggttcttcaactcgagg
cacaaaaataactacaagatctacaacctatgttcagagagaaactacgaccccaacaag
ttcaactgccaggtggcgcagtacccgttcgacgaccactctccgccgcagctggagctc
atgcgtctgttctgcgaggacttggactcgtggttggggcaggacgccaaacacgtggca
gcggttcactgtaaggcgggaaaaggtcgcactggggtcatgatctgcgcctacctcctc
caccgcggccagttcaccacgcccgaagacgtgctcgagttctacggacaggcgcgcacc
accgaccgcaagggtgtgacgatccccagtcagcgcaggtatgtgtcgtattacagtgtt
ctcctgaagaaccgactccagtacaaacccacagccctgctcctgcacaaggtcctgttc
cacaccgtgcccatgttcaccaacggaacctgcaatcctcagttcgtggtgttccagctc
aaagtgaagctcttcacgtcaaactctgctctgaccaaacgagaagacaaacatctgcag
atggacctgccccagcccctgcccctgtgcggagacgtcaaggtggagttctaccacaag
accagcaagatcaccaagaaagagaagatgttccacttctggttcaacacgttcttcgtc
ccagaacctccccccaatggacagaaccacgagaacggaggctcccagcagaaccggaag
aggggaggaggaggagaagaggagagaggagaggagagaggaggaggagcagaggaacag
agcggcccggactttctcaccctcagcctctgcaaacaagagctggacaaagccaacaag
gaccagagccaccggaacttctccccaaacttcagggtggagttgtttttcacgaagccg
caggaggacggcgccggctcagactccgcctcctcggtgacgccggacgccagcgacgcc
gagctcgaccagtaccactactccgacaccacggactcggaccaggaccaggactcggac
ccggagccggacctggaccaggactatcaggtgtcccgggtctga

DBGET integrated database retrieval system