KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166405Help
Entry
110166405         CDS       T05002                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00020  Citrate cycle (TCA cycle)
bpec00310  Lysine degradation
bpec00380  Tryptophan metabolism
bpec01100  Metabolic pathways
bpec01200  Carbon metabolism
Module
bpec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpec_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110166405
  09105 Amino acid metabolism
   00310 Lysine degradation
    110166405
   00380 Tryptophan metabolism
    110166405
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     110166405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 110166405
NCBI-ProteinID: XP_020787302
LinkDB All DBs
Position
Unknown
AA seq 1040 aa AA seqDB search
MHRLRTCAARLRPLTATQTAQTAGPKRPITAQYPGGARTFQPIRCYSAPVASEPFLNGTS
SNYVEEMYFAWLENPKSVHKSWDVFFRNANAGAPPGAAYQSPLGLSPAMISPLGAAVSAQ
PNVEKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSCVPTDIITSSDKLDRASE
KRANQLWKLGKGFYGLDESDLDKVFRLPTTTFIGGAESALPLKEIIRRLEMAYCQHIGVE
FMFINDLEQCQWIRQKFETPGVMQFTLEEKRTLLARMVRSTRFEEFLQKKWSAEKRFGLE
GCESLIPALKTIIDKSSENGVENVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAAD
EGSGDVKYHLGMYHRRINRVTDRNITLSLVANPSHLEAVDPVVQGKTKAEQFYCGDNDGK
RVMSILLHGDAAFAGQGIVYETFHLSDLPSYSTHGTVHVVVNNQIGFTTDPRMARSSPYP
TDVARVVNAPIFHVNADDPEAVMYVCNVAAEWRATFHKDVVVDLVCYRRMGHNEMDEPMF
TQPLMYKQIKKQKPVLQKYAEKLIAEGAVTRQEYEEEIAKYDKICEEAYARSKDEKILHI
KHWLDSPWPGFFTLDGQPKSMSCPSTGLTEENLNHIGSVASSVPVEDFTIHGGLSRILKG
RGEMIRNRTVDWALGEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCI
PMNHMSPDQAPYTVCNSSLSEYGVLGFELGFAMASPNALILWEAQFGDFHNTAQCIIDQF
ICPGQAKWVRQNGIVLLLPHGLEGMGPEHSSARPERFLQMCNDDPDVHPPITEDFAVQQL
YDCNWIVVNCSSPGNYFHVLRRQILLPFRKPLIVFTPKSLLRHPEARSSFDEMLPGTHFQ
RLIPDTGPAAQNPQAVKRVLFCTGKVFYELNKERKNRGLEEQVAIARVEQLSPFPFDQVK
AEVERFPNADLVWCQEEHKNQGYYDYVKPRIRTTIQRNKPVWYAGRGPAAAPATGNKNTH
LMELRRFLDAAFDLDTLRME
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcctcaggacttgtgcggcacgtttgcggccgctcacggcgacgcaaaccgct
cagactgccggccccaagcggccaatcacagcccagtatccgggcggagcaaggacgttt
cagccaatcaggtgctactctgctcctgtggcgtcagagccttttctgaacggaaccagt
tcaaattatgtcgaggaaatgtacttcgcctggctggagaacccaaagagtgtacacaag
tcatgggacgtgtttttccgtaacgcgaacgccggagcgccccctggtgccgcgtaccag
tctcctctgggtctgagcccggccatgatctctcctctcggcgccgctgtctctgctcag
cccaacgtggagaagctggtggaggatcatttggcggtgcagtcgctcatcagggcctat
cagatccgcgggcaccatgtggctcagctggacccgttgggcatcatggacgccgatctc
gactcttgtgttcccactgacattatcacgtcctccgacaagctggacagagcctctgaa
aaacgcgctaaccaactgtggaaactcggcaaaggattctatggtctggacgagtcggac
ctggacaaggttttccgtctgcccacgaccacgttcatcggaggagctgagagcgcgctg
cctctgaaggagatcatccgccgactcgagatggcgtactgtcagcacatcggtgtagag
ttcatgttcatcaatgacctggagcagtgtcagtggatcaggcagaagtttgagactcca
ggagtgatgcagttcactctggaggagaagaggacgctgctcgctcgcatggtccgctcc
accaggtttgaggagttcctgcagaagaagtggtctgcagagaagcgctttggtctggag
ggctgtgagtctctgatcccagctctgaaaaccatcattgacaaatcctcagagaatgga
gtggagaacgtcatcatgggcatgccccacagggggcgcctcaacgtgctcgccaacgtc
atccgcaaagagctcgagcagatcttctgtcagtttgactcaaagctggaagcggctgac
gagggctctggggatgtgaagtaccacttgggcatgtaccatcgtcgtataaaccgtgtc
acggacagaaacatcactctgtctctggtggcgaacccgtctcacctggaggccgtggat
cctgtggtccaggggaagaccaaagccgagcagttttactgtggagacaacgacggcaag
agggtgatgtccatcctgcttcatggagacgctgcgttcgctggtcagggaatcgtctac
gagacgtttcacctgtcagacctgccgtcttactccacccacggcaccgtgcacgtggtc
gtcaacaaccagatcggcttcaccacagatccccgtatggctcgctcgtccccctatccc
acagatgtggctcgtgtggtgaacgctccgatctttcatgtaaacgcagacgaccctgag
gcggtgatgtacgtgtgtaacgtggctgcagagtggagagccactttccacaaggacgtg
gtggttgatctggtctgctatcgtcgtatgggtcacaacgagatggacgagcccatgttc
actcagcccctcatgtacaaacagatcaagaaacagaagcccgtgctgcagaagtacgcc
gagaaactgatcgcagagggagccgtcaccagacaggagtacgaggaggagattgcgaag
tacgataagatctgtgaggaggcgtacgctcgctccaaagacgagaagatcctgcacatc
aagcactggctggactcaccttggcctggttttttcactctggatggacagcccaagtcc
atgagctgcccctccactggtctgactgaagaaaacctcaaccacattggaagtgtggcc
tcctctgtgcccgtggaggacttcaccatacacggaggtctgagcaggatcctgaagggt
cggggggagatgatccgtaacaggacggtggactgggctctgggcgagtacatggccttt
gggtctctgctgaaggagggaatccacgtgaggctgtccgggcaggacgtggagagaggc
accttcagccaccgtcaccacgtgctccatgatcagaacgtggacaaacgcacctgtatc
cccatgaaccacatgagtccagaccaggcgccgtacaccgtctgcaacagctctttgtca
gagtacggagtcctcggtttcgagctgggttttgcgatggcgagcccaaacgctctgatc
ctgtgggaggctcagttcggagacttccataacacagctcagtgcatcatcgaccagttc
atctgcccgggtcaggccaagtgggtcagacagaacggcatcgtgctcctgttgccccac
ggactcgagggcatgggtccagaacactcctccgcccggccagagaggttcctccagatg
tgcaacgatgaccccgacgtgcacccgccgatcacagaggactttgccgttcaacagttg
tacgactgtaactggatcgtggtgaactgttcgtcgccaggaaattacttccacgttctg
agacgccagatccttctgcccttcaggaaaccattgatcgtcttcactccaaaatcactt
ctgcgccacccagaggccagatccagcttcgacgagatgctcccagggactcatttccag
aggctgattcctgacacaggcccggccgctcagaacccacaggctgtgaagagagtcttg
ttctgcaccggaaaagtcttctacgagctcaacaaagagaggaagaaccgcggcctggag
gagcaggtcgccatcgccagggtggagcagttgtctccgttcccgttcgaccaggtgaag
gccgaggtggagaggttcccaaacgcagatctggtctggtgtcaggaggagcacaagaac
cagggctactacgactacgtgaaacccaggatccgcaccactatccagagaaacaaacca
gtgtggtacgccgggcgaggaccagcggccgctccagccacgggaaacaaaaacactcac
ctgatggaactcaggcgcttcctcgacgccgccttcgacctggacacgctcaggatggag
tag

DBGET integrated database retrieval system