KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166422
Entry
110166422         CDS       T05002                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04080  Neuroactive ligand-receptor interaction
bpec04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110166422
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110166422
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bpec04030]
    110166422
G protein-coupled receptors [BR:bpec04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    110166422
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 110166422
NCBI-ProteinID: XP_020787318
LinkDB
Position
Unknown
AA seq 359 aa
MASEMMWPTCNNSHNVTFFYNWVGKKINTEWTTRDAVVIGLGLTVCLVVVLANLMVMIAI
FKNHRFHFPIYYLLSNMAAADLFAGVAYINLMLNTGPWTSTLTKEQWYIRGALIDISLTA
SVANLLAVAVERHQTIMTMQQHSKMTKRRVSLLIVCIWVVSILMGLIPSTFWNCECDLND
CSTVAPLYSRRFLVFWAALNLLTFFIMVAMYTRIFCYVRYQSRYSSGHTSNQTVDNLMKT
IFMVLGAFVICWTPGLVTLLLDGLLGKASHANAFEKFCLVIAECNSLVNPIIYSLRDNEM
RSTFKSILCCLCRGCPGQQRARSPIAIDPPFPEETLDCLHKPEEAHGSPRNINRIFEHA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcctcagagatgatgtggcctacctgcaacaacagccacaatgtgacctttttctac
aactgggtggggaaaaagatcaacacagaatggaccacccgagatgctgtggttattgga
cttgggcttacagtttgtctcgtagttgtcctggccaacctcatggtcatgatagccatc
ttcaagaaccaccgcttccactttcccatttactacctcctgagcaacatggcagctgct
gacttgtttgctggtgtggcttatatcaatcttatgctgaacactggcccttggaccagc
acactcacaaaagagcagtggtacatacgaggagctttgattgatattagtctcactgcc
tccgtcgcaaaccttttggctgtagccgtagagcgccatcaaaccatcatgaccatgcag
cagcacagtaaaatgaccaagcgccgtgtgtcactgcttatagtgtgtatctgggtggtt
agcatcctcatggggctgattccatccacgttttggaactgtgagtgtgacctgaatgac
tgctccactgtggcacctctttacagtcgcaggtttcttgttttctgggcagctctgaac
ctgctcacattctttattatggtggcgatgtacactcgtatcttctgttatgtcagatac
caaagcagatactcatcaggccacaccagcaaccagactgttgacaacctgatgaagact
attttcatggttctaggtgctttcgtgatctgttggactcctggactggtgaccctgctg
ctggacgggctgctgggaaaagccagtcacgccaatgcctttgagaagttctgcctggtg
atagcagagtgcaactctttggtcaatccaatcatatattctctacgggacaatgagatg
aggagcacttttaaatcaatcttgtgctgtctgtgtcgtggatgtcctggccagcagagg
gcgcgctctccgattgcgatagacccgccgtttcctgaggaaactcttgactgtctgcac
aagccagaagaagcccatggttcacctcgaaatataaatagaatatttgaacacgcctga

DBGET integrated database retrieval system