KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166448Help
Entry
110166448         CDS       T05002                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00052  Galactose metabolism
bpec00500  Starch and sucrose metabolism
bpec01100  Metabolic pathways
bpec04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110166448 (gaa)
   00500 Starch and sucrose metabolism
    110166448 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110166448 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpec04147]
    110166448 (gaa)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110166448 (gaa)
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110166448 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110166448
NCBI-ProteinID: XP_020787351
LinkDB All DBs
Position
Unknown
AA seq 923 aa AA seqDB search
MRLRLHYHESGSIAAVSVAFAYVNLLIVAASCSDVWRYENQIKNHTLREISTGSKNEKMS
NIFSKNDKCAMALERRFDCARDKVVSQSECEDRGCCYAPLSDLAGPPWCYFPHLYPGYVM
GPLTPSQRGRAATLTLAKASYLPKEIPTLNMEVMEETAECLHLTLKDPTSPRYEVHLPGQ
QSAPQRKARPQNALYSILFQHNPFGFTVLRNSNNRVIMNTTVAPLLFADQYLQLSTTLAS
PFVSGLGQHYTSLSLDLNWTSVTLWNQDTKPRVDANLYGSHPFYIVQEEDGFAHGVFLLN
SNAVEVVLQPTPALTLVALGGILDLYVFLGPDPESVIRQYLQVIGYPMMPPYWALGFHLC
RWGYTTSNTTRQVAQHMHDANFPMDVQWNDLDYAHDRRIFTFDPWRFGDLPEMVQDFHER
GLKYVLILDPGISTTSPPGSYPPFDDGLKRDVFIKNATGNLLIGKVWPGPTAFPDFTSPE
TRQWWEDCIKEFISKVPVDGLWIDMNEPSSFVRGSVDGCPDTDLESPPYTPPVVGGQLNS
KTLCMSAQHLLSTHYNLHNIYGLTEAFATYKALINIQRKRPFVLSRSSYPGIGRFSGVWT
GDVTSNWDQLRYSIPTVLMFGLYGVPLVGADVCGFEGNTTEELCVRWMQLGAFYPFMRNH
NDRQNRPQEPYVFGKKSQAAMRSALNLRYSLLPFLYTLFHHAHTSAETVARPLFVEFPHD
PNCRTIDRQFLWGSALLISPVLEQGVVEFSAYFPFGTWYSLLDGQPFYSKGQYLLLSAPL
DTINVHVREGHIIPQQETALTTLASRTNPFFLTVALSAGGWAWGDLFWDDGESLDTFEKS
SYSYVIFIAGQAQIISDPVRLNGDLDGLVLGGVRVFGVSSPPHYVLANGEKVSDFTYHSD
TKALIVNKLALPMSKVFTVQWAL
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgagactcagattgcattaccatgaatctggctcaatcgctgcagtttctgtagcgttt
gcttatgttaacttgttaatagttgctgcctcctgcagtgatgtttggagatatgaaaat
caaattaagaaccacacattgagggagattagtacaggttccaaaaatgagaaaatgtct
aatattttttctaaaaacgacaagtgtgccatggcgctcgagcgtcgctttgactgtgcc
agagataaagtcgtcagtcagtcagagtgcgaagacagggggtgctgctacgcccccttg
tcagatttagctggaccaccatggtgctattttccgcatttgtatcctggctacgtcatg
ggtcccctcactcccagtcaaagaggacgggcagccactttgacccttgccaaagcgtca
taccttcccaaagagatacccactctcaatatggaggtgatggaagagactgcagaatgc
ttacacctcactctaaaagaccctacatctccaaggtatgaggttcatctgccagggcag
cagtctgctcctcagaggaaagcaaggccacagaatgccctatactccattctgtttcaa
cataacccttttggttttacggtacttcgtaattcaaataatagagtaatcatgaacaca
actgtggctcctcttttattcgcggatcagtaccttcagctgtcaacaacactggcttcc
ccctttgtgtctggccttggacaacattacacttccttaagtctagacctgaactggaca
tctgtaacactgtggaaccaagacactaaaccccgtgttgatgcaaacctctatggttct
catcccttttacatagtccaagaagaggatgggtttgcacatggagttttcctgctaaac
agcaatgcagttgaggtggtactgcagcccacccctgctcttactttggtcgctcttggt
ggaattctggacttgtatgtttttttgggacctgatccagaaagtgtaatacgccagtat
cttcaagttattggttacccaatgatgcctccttactgggctctgggctttcacctttgt
cgctggggatacacaactagtaatacaacccgacaagtggcacaacacatgcatgatgcc
aattttcccatggatgtgcaatggaacgacctagactacgcacatgatcgcaggatcttc
acctttgacccttggcggtttggtgatcttccagagatggtgcaggattttcatgaacga
ggcttaaaatatgtcctcattctggatccaggtatcagtaccactagccctcctggatca
taccctccattcgatgatggcttaaaaagagatgtgtttatcaaaaatgccactggaaat
cttctcattgggaaggtgtggcccggaccgactgcctttcctgacttcactagtccagag
accagacaatggtgggaggactgcattaaagagtttatttcaaaggtgcctgtggatggc
ctgtggattgacatgaatgaaccctccagttttgtgcgtggctcagtagatggctgtcct
gacactgatctggagagtccaccctacactccaccggttgttggcggccagttaaattca
aaaacactttgcatgtcggctcaacacctcctgtctactcactacaacctgcataatatt
tatgggcttacagaagcatttgccacttacaaggcgctcataaatattcaaagaaaacga
ccctttgtcttgtctcgctcttcctaccctgggattggacgtttttctggagtgtggact
ggtgatgtcacaagtaactgggatcagcttagatattcaatccctactgtcctgatgttt
ggtctgtacggggtgccacttgtgggagcagacgtgtgtgggtttgaagggaacactact
gaagagttatgtgtgcggtggatgcagcttggagccttttatccattcatgaggaaccac
aatgataggcaaaatagaccccaggagccttatgtatttggaaagaaatcccaagcagcc
atgcgcagtgctctaaacctgcgctactctctccttccattcctttacacgctgtttcat
cacgcacacacttctgctgagactgtggccagacccctttttgttgaatttcctcatgac
cctaattgtcggaccattgaccgacagttcttgtggggcagtgctcttctcatcagccca
gtccttgaacaaggagtggtagagttttcagcctacttcccctttggcacctggtacagc
ctcctcgatgggcaacctttctacagcaaggggcaatatttgctcctttcagctccattg
gacaccatcaatgttcatgtcagagagggacacataatacctcagcaggaaactgctttg
acaaccttggcatcccgcaccaatcctttctttctgacagttgcattgtctgcaggagga
tgggcatggggtgacctgttttgggatgatggagaaagtcttgacacatttgagaaaagt
agttatagctatgtcatcttcattgcggggcaggcacagattataagtgaccccgtgaga
ctaaacggggacctagatggattggtgctgggaggtgtccgtgtttttggtgtatcctcc
ccacctcactatgttctagccaatggggagaaagtcagtgattttacctaccacagtgac
acaaaagctttaattgtgaacaagttggccttgcccatgtcaaaggttttcacagttcag
tgggctctttga

DBGET integrated database retrieval system