KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110166528Help
Entry
110166528         CDS       T05002                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00250  Alanine, aspartate and glutamate metabolism
bpec00410  beta-Alanine metabolism
bpec00430  Taurine and hypotaurine metabolism
bpec00650  Butanoate metabolism
bpec01100  Metabolic pathways
Module
bpec_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110166528 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110166528 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110166528 (gad1)
   00430 Taurine and hypotaurine metabolism
    110166528 (gad1)
Enzymes [BR:bpec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110166528 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110166528
NCBI-ProteinID: XP_020787435
LinkDB All DBs
Position
Unknown
AA seq 591 aa AA seqDB search
MAASAPSSGGEPDPNNSTNLRPPGSSYDAWCGVAHGCTRKLGMKICGFLQKNNSLEERSR
IVSSFKERSAKNLLSCDNSGQETHFRRTETDFSNLYARDLLPAKNGEEPTMQFLLEVVDI
LTNYIRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTG
HPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLRKMREIVGWRDGE
GDGIFSPGGAISNMYSVMVARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKASAALGF
GTENVILLSTDERGRVIPADLEAKVIATKQKGYVPLYVNATAGTTVYGAFDPINEIADIC
EKYNIWLHVDGAWGGSLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVRERGL
LQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHIDKC
LDLSAYLFNKIKNREGYKMVYEAEPQHTNVCFWYYPPSLRSLPEGEDKRERLHKVAPKIK
AMMMESGSTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLIDEIERLGHDL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgcaccctcctctggcggcgaaccggatcccaacaactcgactaattta
cgaccaccgggctcaagttatgacgcgtggtgcggagttgctcatggatgcacgaggaaa
ctggggatgaagatctgtggtttcctgcagaagaacaacagtctggaggagaggtcccgg
atcgtgagctccttcaaagagcggagcgccaagaacctgctctcgtgcgataacagcggc
caggagacgcacttccgacgcacggagacggacttctccaacctgtacgccagagatctc
ttgcctgccaaaaatggagaagagccgaccatgcagttcttgctggaggtggtggacatc
ctcaccaactacatccggaaaacctttgaccgctccaccaaggtcctggatttccatcac
cctcaccagctgctggagggcatggagggcttcaacctggagctgtcagaccagcctgag
tccctggagcagatcctggtggactgcagggacactctgaagtatggcgtccgcacaggc
caccccagattctttaaccagctgtctaccggcttagacattgtgggtttggctggggag
tggctcacgtcaaccgcaaacaccaacatgttcacctatgagatcgcccctgtgtttgtc
ctcatggagcagctcactctgaggaagatgagggagattgtgggctggagagatggagag
ggcgatggaatattctctccaggtggtgcaatctccaacatgtacagtgtgatggtggcc
agatacaagtacttcccagaagtgaaaaccaaaggcatgtcagctgcccccagactggtc
ctcttcacctcagagcatagccactactccatcaagaaagccagtgctgctttgggtttt
gggacagagaatgtaatacttttaagcacagatgagaggggaagagtcatcccagctgat
ttggaggctaaagtaatagcaaccaaacagaagggctatgttcccttgtatgtgaacgcc
acagccggtactaccgtctacggagcctttgaccccatcaacgaaatcgctgacatctgt
gaaaagtacaacatctggcttcatgtggatggggcatggggaggcagtctgctgatgtct
aggaaacacaggcacaagctcaatggagtagaaagggctaactcagtcacctggaaccct
cacaagatgatgggagtgccactgcagtgctctgccattctcgtccgagagaggggcctt
ctgcagggctgtaactccatgtgtgcgggttacctcttccaaccagacaaacagtatgac
gtcacatatgacactggggacaaagccatccagtgtggacgccatgtcgacatcttcaag
ttctggctcatgtggaaggcaaagggaacagtaggatttgagcagcatatcgacaagtgc
ctggatctgtctgcatacctcttcaataaaatcaaaaacagagaaggctacaagatggtg
tatgaggcagagccccagcacacaaacgtctgcttctggtactaccctccgagcctgcgc
agcttacctgaaggagaggacaagagggagagactgcacaaggtggctccaaagatcaaa
gctatgatgatggagtctgggagcaccatggtgggctaccagcctcagggagacaaggtc
aacttcttccgcatggtcatctccaacccggcagccaccaggtcagacatcgacttcctc
attgacgagatcgaacgcctgggacacgacctgtaa

DBGET integrated database retrieval system