KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110167945Help
Entry
110167945         CDS       T05002                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00590  Arachidonic acid metabolism
bpec01100  Metabolic pathways
bpec04370  VEGF signaling pathway
bpec04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110167945 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110167945 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110167945 (ptgs2)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110167945 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosducin An_peroxidase EGF Toxin_27
Motif
Other DBs
NCBI-GeneID: 110167945
NCBI-ProteinID: XP_020789010
LinkDB All DBs
Position
Unknown
AA seq 817 aa AA seqDB search
MYKLATAVLLFALGVLVCKGDNPCCSQPCENRGVCMEKGTDAYECDCTRTGFYGQNCTQP
EFMTWLKVTLKPTPNTVHYILTHFKGFWNIVNGISFLRDAIMSYVLTSRSHMIDSPPTYN
ADYGYKSWEAYSNLSYFTRTLPPVPEDCPTPMGVVGKKELPDAKELAEKLLVRRRFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKRGPAFTEAPGHGVDLSHIYGVSLDRQHKLRLFKDGK
LKYQMLNGEMYPPTVKEVGVDMHYPPHVPESQRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPYWDDERIFQTARLILIGETIKIVIEDYVQHLSGYYFKLKFDPELLFHKKF
QYQNRISSEFNTLYHWHPLMPDSFHIEERDYSYKEFVFNTSVVTEHGIGTLVDSFTKQIA
GRVAGGRNVPGPILYVSIKSIENSRKMRYQSLNAYRKRFNMKPYASFEDMTGDKEMAAIL
EEMYGHVDAVELYPGLLVEKPRENAIFGETMVEMGAPFSLKGLMGNAICSPEYWKPSTFG
GQVGFDIINTASLQKLVCNNVKGPCPVASFHVPDENTPAKMSDRLLDLDESATQTGPKGV
INDWRRFKLESMDKESLPPAKRELLRQMSSPGKPKDGDNIAEQNRKMSVQEYEMLKEEDE
GCLKKYRKRCMQEMHEKLSIGPRFAGVHELESGDAFLEVIEKEHHSTLVVVHIYKLGLKT
CEDLNHCLDCLATEYPTVKFCRINAVSSGASERFSDDVLPTLLVYKAGELIGNFLACTQH
LNQEFFATDVEAFLNSYGLLPEKELPCLDDEEENDVE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgcgacggcggttctgctttttgcgctcggcgttctggtctgcaaaggg
gataatccttgctgttcacagccatgtgagaacagaggagtctgcatggagaaaggcaca
gacgcttatgaatgtgactgtacacggacagggttttacggacaaaactgcacacaaccg
gaattcatgacatggctcaaagttaccctcaaaccaacgccaaacacagtgcactatatt
ctcacacattttaagggcttctggaatattgtgaatggaatttcatttttacgtgacgcc
atcatgagttacgtcctcacgtctcgttcacatatgatagacagtccaccgacgtataat
gcagactatggctacaaaagctgggaagcctattcaaacttgtcctacttcacccggacg
ctcccccctgtaccagaggattgcccaacaccaatgggagtcgtaggtaagaaggagctg
cccgacgcaaaggagttagcagagaagctcttagtgcgcagacgtttcatcccagaccca
cagggcaccagcctcatgtttgcattcttcgctcaacatttcacccaccaattcttcaaa
tctgacatgaagaggggccctgcattcactgaagcacctggtcatggggtggatctcagt
cacatttatggagtttctctggacagacaacacaagctgagacttttcaaggatggcaag
ctcaaatatcagatgctgaatggagagatgtaccccccgacagtgaaggaggtcggtgtg
gacatgcactatcctccccatgtcccagagtcccagaggtttgcagtggggcatgaagct
tttggcctggtccctggtctcatgatgtacgctaccatctggcttcgtgaacacaaccga
gtatgtgacgtgctaaaggaggtccacccttactgggacgatgagagaatattccagact
gcaagactcattctgattggagaaactatcaaaattgtcatcgaggactacgtgcagcat
ctgagcggctattactttaagctcaagtttgaccctgagcttcttttccacaagaaattt
caataccagaaccgcatctcatcagagtttaacaccctgtaccactggcacccgctcatg
ccagactccttccacatcgaggagagagattacagctacaaggagtttgtctttaataca
tctgtcgtgactgaacatggcatcggtaccctggtggattcctttaccaagcagatcgct
ggacgggttgctggtggtagaaatgtcccaggcccaattctctatgtgtccatcaagtcc
attgaaaacagcagaaaaatgcgctaccagtctctgaacgcatacaggaagaggttcaac
atgaaaccctacgcctcatttgaagacatgacaggagataaagaaatggcagccattttg
gaggagatgtacggacacgtggacgccgtggagctgtacccgggtctgctggtcgagaag
cccagagagaacgccattttcggggagaccatggtggaaatgggagcacccttctccctc
aaaggcctcatgggaaacgccatctgctcccctgaatactggaagccaagcactttcgga
ggccaggtgggcttcgacatcatcaacacagcctcgctacaaaagctcgtgtgcaacaac
gtgaagggtccttgccctgtggcgtcctttcacgtgcccgatgaaaacacacctgcaaaa
atgtctgaccgactcctggaccttgatgagtctgccacccaaacagggccaaagggtgtg
atcaatgactggcggaggtttaaactggagagcatggataaggagagtcttcctccagcc
aagagggagctgctccgacagatgtcctcccccggcaaacccaaggacggggacaacatc
gcagaacagaacagaaagatgagtgtccaggagtacgagatgctgaaggaggaggacgaa
ggctgtctgaagaaataccgcaagcgctgtatgcaggagatgcatgagaaactgagcatt
ggacctcgctttgcgggcgtgcacgagctggagagcggggatgccttcctggaggtcata
gagaaggagcaccacagcaccctggtcgtggtccacatatacaagctgggcctcaaaacc
tgcgaggacctcaaccactgcctggactgcctggccacagaataccccaccgtcaagttc
tgcaggatcaacgccgtctcctccggggcgtctgagcgtttttccgatgacgtcctgccc
actctgctggtttacaaagccggagaactcatcgggaattttctggcctgcacgcagcat
ctaaaccaggagttttttgcaacggatgtggaagcatttctcaacagttacggtctcctg
cctgaaaaagagctcccgtgtttggatgatgaggaggagaatgatgttgagtga

DBGET integrated database retrieval system