KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168634
Entry
110168634         CDS       T05002                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04012  ErbB signaling pathway
bpec04068  FoxO signaling pathway
bpec04110  Cell cycle
bpec04115  p53 signaling pathway
bpec04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110168634
   04068 FoxO signaling pathway
    110168634
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110168634
   04115 p53 signaling pathway
    110168634
   04218 Cellular senescence
    110168634
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110168634
NCBI-ProteinID: XP_020789757
LinkDB
Position
Unknown
AA seq 164 aa
MCKNMAAHKRILGALGNGTTRRNLFGPVDRDQLQVEYQAALRKDLEEASIRWGFDFIRDK
PLNSSDFQWEGIPGTKVPLLYRSCMLEQAEGNSIAAAVSHKVESPQSDKENIPQSPERCS
LDLKKLERTPERGEFTGLKRKQTNITDFYQAKRRVVGKPRKSGE
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtgtaaaaacatggctgctcacaagcgcatcctgggagccctgggaaacgggacgact
cggagaaatctctttgggcctgtggacagagaccagctgcaggtggagtaccaggctgcc
ctgcgcaaagacctggaggaggcctccatccgctggggctttgatttcatccgggacaag
cccttgaacagcagtgatttccaatgggagggcatcccaggcactaaggtgccactgctg
taccgctcatgtatgttggaacaagcagaggggaacagcatagcagcagcagtttcccac
aaggtggagtcacctcagagtgacaaggaaaacatcccacaatccccagagagatgttca
ctggacctgaagaagttagaacgaacgccagagcgaggagagtttacaggtctcaagagg
aaacaaactaacattacagatttctatcaagccaaaaggcgagttgttggaaaaccacgg
aagtctggagagtga

DBGET integrated database retrieval system