KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168686
Entry
110168686         CDS       T05002                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 110168686
NCBI-ProteinID: XP_020789821
LinkDB
Position
Unknown
AA seq 361 aa
MSVGELIELRDLVSAGDRIELTASHSPCFPPRLERTNALRISAGKVPELLSRVGIIRVLS
SRSDPQPPEERGEGHNFQPCSHTQPTWCDLCGDFIWGLYKQSLRCVNCKFTCHYRCQPLI
QLDCIWDQGSLSENTQVVEHTIETDTNVDEQTEWAKQELTTPDIQQKVKEYNAQINSNLF
MNVNKDGSYTGFVKVQFKLARPVSVPPPKKETGRKSAGVKRRTSFYLPKDASKHLHISSR
TTAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLSAGPNEKLL
SFVLKENETGEVNWHAFSMPELKNFLRILQREEEEHVKQIVQRYALARTRMQEALSGSTP
G
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctgtgggtgagctgatcgagctcagagacctggtttcagccggagaccgcatcgag
ctgaccgcgtcccactccccttgcttccctccgcgcctggagaggaccaacgctttgagg
atcagtgcggggaaagtgccagagctgctgagtcgtgtgggcatcatcagggttctgagc
agtcgcagtgatccccagcctcccgaggagagaggggagggacacaactttcagccatgc
agccacactcagcccacctggtgcgacctgtgcggagacttcatctggggactgtacaaa
cagagtctgcgctgtgttaattgtaaattcacttgccactaccgctgccagcccctcatt
cagctggactgcatttgggaccaaggctctctgtctgaaaatacacaagtcgtcgagcac
acaatagagaccgacacgaatgtggatgaacagactgaatgggcaaagcaggagttgacg
accccagacattcaacaaaaagtgaaggaatacaacgcacagatcaacagcaatttattc
atgaatgtgaataaggatggctcttatacgggtttcgtaaaggtgcagttcaaattggca
cggcctgtttcagttcctcctccaaagaaggagactgggaggaaatcggcaggggtgaag
cgccgcacctctttttacctgcccaaagatgcctccaagcacctgcacataagctcccgc
accacagcccgcgaggtcatcgaggccttgctcaagaagtttactgtggtcgataatccg
gggaagtttgcactgtttgagcgaagtgaacgccatgatcaagtttatgtccgtaagctg
tctgatgatgagcgaccactgcgcttgcgtctcagtgctggacccaatgaaaagctgctg
agttttgtcttgaaggaaaatgaaactggagaagtcaattggcatgccttctcaatgccg
gagttgaagaacttcctccgtattcttcagcgtgaggaagaggagcacgtgaagcagata
gtgcagcgttacgctctggcccgcactcggatgcaggaggcgctctccggctccactcca
ggctga

DBGET integrated database retrieval system