KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168760
Entry
110168760         CDS       T05002                                 

Definition
(RefSeq) probetacellulin-like
  KO
K08774  transforming growth factor, alpha
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110168760
   04012 ErbB signaling pathway
    110168760
SSDB
Motif
Pfam: EGF Ninjurin LapA_dom Laminin_EGF DUF1180
Other DBs
NCBI-GeneID: 110168760
NCBI-ProteinID: XP_020789907
LinkDB
Position
Unknown
AA seq 199 aa
MMAKILWDTILLISGSLFTFGAGQNNSTLSDANVSFKSNSTNLPYFSTNNFSSPSPTTIA
TSTTGTTPIKKFVAAAVRSHFDECPDSHRHFCFHGTCRFLILEETPACVCHQGFVGIRCE
HADLLAVVATKNSQNTYATVLVFCVISCILLAVLVTLLHCWWRQLCRRRRYAHHYASEKN
SSGVSYWPSESGMECYIMR
NT seq 600 nt   +upstreamnt  +downstreamnt
atgatggcaaagattctctgggacacgatcttattaataagtgggtccctctttacattt
ggagcagggcagaacaattcaacacttagtgacgccaacgtctcctttaagagtaactct
acaaatttgccatatttttcaacaaataacttttcatctccaagcccaacaaccattgca
actagcacaacaggcactactcctattaaaaagtttgtggcggcggcagtgcggtctcac
tttgacgaatgccctgactcccatcgtcacttctgttttcatggaacatgtcgctttctc
attctggaggagacacctgcgtgtgtgtgtcatcaaggtttcgtggggatacgatgtgag
catgcagacctattggcggtagtagccaccaaaaacagtcaaaacacctacgccacagta
ttagtgttctgtgtcatcagttgcatccttttagcagtgctggttactcttctacactgc
tggtggagacagctctgccgtcgtagaagatatgcacatcactacgcctctgagaagaac
agtagtggagtgtcctactggccatcagaaagtggtatggaatgctacatcatgagataa

DBGET integrated database retrieval system