KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168770
Entry
110168770         CDS       T05002                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 110168770
NCBI-ProteinID: XP_020789917
LinkDB
Position
Unknown
AA seq 357 aa
MSKCELIELQDLSVNDPIELAAPGTHHTPAPTVLPAGPSGFSHVVRLVGDRVSIETALSE
KTGLGHDFQPFRQTHPTWCDLCGDFIWVLYKQQSLRCAKCCYTCHHRCRPFIQLDCSTDE
GAPTDKPGSPGDCFESDTNVDDNIEWDQQELSHAEIQQKILEYNSQTNNNLQMVIQKDGS
YTGFIKVHFQLVRPISLPPPQGMRPLDAQWDERMRRRTSFYLPKDAAKHLHISSQTQVQE
VIIALLNKFTVVDNPAKFALFERTERQNQVFMRKLSQDERPLYLRLCAGPNEKVLSLVLK
ENETGEVDWDAFSFPELCNFLRILQREEEEHVRQIVKRYTLARERMMHAMSKFKSCS
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagttgattgagctccaagacctcagtgtgaatgaccctattgagcta
gctgctcctgggacacaccacacacctgcacccacggttctgcctgcgggaccatcaggc
ttctcccacgtggtgcgcctggtgggggacagagtcagtattgagacagcgctctcagaa
aagactggactaggacacgacttccagcccttcagacagacccatcccacctggtgtgat
ctgtgtggggactttatttgggttctttacaaacagcagagtctgcggtgtgccaaatgc
tgctacacttgtcaccaccgctgtcgcccatttatccagctggactgcagcacagatgag
ggggcacccactgacaagccaggctctccgggggactgcttcgaatcagacacaaatgtg
gatgataatattgaatgggatcaacaggagttaagtcatgcagagattcagcaaaagatt
ttagagtataattcccagaccaacaacaatcttcaaatggtcatccagaaagatggctct
tacactggtttcattaaggtgcactttcagttagtccgcccaatttccctgccccctcct
cagggtatgcgcccattggatgctcagtgggatgaaaggatgagacggcgaacatctttc
tatctacctaaagacgctgcgaaacacctccacataagttctcaaacacaagtccaagag
gtcatcatagccttgctcaacaagttcactgtggtggacaacccagcaaagtttgccttg
ttcgaacggactgagagacaaaatcaggtgtttatgaggaaattgtctcaggatgagcgt
cccctgtacctgcgtttgtgtgccggccccaatgaaaaagtcctgagtctagttttgaaa
gagaatgagactggggaagttgattgggatgctttcagttttcctgaattgtgcaacttc
ctgagaatcctgcagcgtgaagaagaggagcatgtacgacaaattgtgaagcgctacaca
ctggcccgagagaggatgatgcatgcaatgtccaagtttaaaagctgcagttga

DBGET integrated database retrieval system