KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168801
Entry
110168801         CDS       T05002                                 

Definition
(RefSeq) transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04137  Mitophagy - animal
bpec04210  Apoptosis
bpec04218  Cellular senescence
bpec04620  Toll-like receptor signaling pathway
bpec04621  NOD-like receptor signaling pathway
bpec04622  RIG-I-like receptor signaling pathway
bpec04623  Cytosolic DNA-sensing pathway
bpec04625  C-type lectin receptor signaling pathway
bpec04920  Adipocytokine signaling pathway
bpec05132  Salmonella infection
bpec05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110168801
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110168801
  09143 Cell growth and death
   04210 Apoptosis
    110168801
   04218 Cellular senescence
    110168801
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110168801
   04621 NOD-like receptor signaling pathway
    110168801
   04622 RIG-I-like receptor signaling pathway
    110168801
   04623 Cytosolic DNA-sensing pathway
    110168801
   04625 C-type lectin receptor signaling pathway
    110168801
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110168801
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110168801
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110168801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpec03000]
    110168801
Transcription factors [BR:bpec03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110168801
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer PBP_N
Other DBs
NCBI-GeneID: 110168801
NCBI-ProteinID: XP_020789949
LinkDB
Position
Unknown
AA seq 599 aa
MAGLYSWGMSPVNPVQQSRPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHP
AIKVHNYSGPLRVRISLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPFNIPEAKVWEEEFDLNSVRLCFQASITLPTGDLYPLEPVV
SQPIYDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDAWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSKPVSVKMQLRRPSDKEVSEPMDFQYLPQDPDEFRVS
VKRKCTADIFQSLKSSSLSSVTIPPERRQITIPRRTVKPQTMNPPPEVAPPAVASLRPQP
SYYPQPSQLFQHQPKVEPSPSLASISTGNLPWKIESLTLSSHPKATPVXXXXXXXXXXXX
XXXXXXXXXDYSTVNIADLHEFFPNFSTAMGLEPPPSSQPPSSSSSSQMPSSQYHVEADY
EDFPSFSDAQDGGTLESLNMDDFVDLVNPVNRLQVSEGGAGQAGCHQLANAASAQHSTAE
GNPGSAWMDYPTSITDLLNNENMIDTLGTGNNGVPHQEIGEFDGFMSTDDERLISIFNS
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcgggcttatattcttggggcatgagcccagtcaatccagttcaacagtccaggccg
tacatagagattatcgagcagcccaagcagagaggcatgcgcttcaggtacaagtgcgag
gggaggtctgccggaagcatccccggagagaagagcaacgacaccaccaagacgcacccg
gctatcaaggtgcacaactacagcggccccctgcgcgtccgcatctccctggtgaccaaa
aacccgccgcacaagccccacccccacgagctggtcgggaaggactgcaaacacggatac
tacgaggccgacctgcaggagcggaggatacacagttttcagaatctgggcatccagtgt
gtgaagaaaaaggatgtgaacgaggccatcacctgccgccttcagaccaacaacaatccc
tttaacattccggaggcgaaggtctgggaggaggagtttgacctgaattcggttcggctt
tgcttccaggcgtccatcactctgcccacgggcgacctgtatcctctggagcccgtcgtg
tcacagcccatctacgacaaccgagcgcccaacacggccgagctgaaaatctgcagagtc
aaccgcaactcgggcagctgcaagggcggagacgagatcttcctcctctgcgacaaggtg
cagaaagaggacatcgaggtgcgcttcttccaggacgcgtgggaggggaagggcacgttc
tcccaggccgacgtgcacagacaggtggccatagtgttccggacgccgccgtaccgcgac
accaacctctccaaacccgtcagcgtcaagatgcagctcaggaggccgtccgacaaggag
gtcagcgagcccatggacttccagtacctgccccaggacccagatgagttcagagtgagc
gtgaagaggaagtgcacggccgacatcttccagagtctcaaaagctcttctctgtcttca
gtgaccatcccaccagagcggagacagatcaccatccccaggagaacggtcaaaccccag
accatgaacccaccgccagaggtggcgccccctgctgttgcctccctccgaccgcagccg
tcctactacccccagccctctcagctcttccagcaccagcccaaagtggagccgtccccg
tccctcgcctccatctccaccggcaacctgccctggaagatcgagagcctgaccctgtcc
agtcaccccaaagccacccccgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnggattactccaccgtcaacatcgccgacctccac
gaattcttccccaacttctccaccgccatgggcctggaacccccgccgtcctcccagccc
ccgtcctcctcgtcgtcctcccagatgccgagctcgcagtaccacgtggaggccgactac
gaagacttcccgagcttttccgacgcgcaggacggcgggaccttggagagcctcaacatg
gacgactttgtggacctggtcaaccccgtcaaccgcctgcaggtgagcgagggcggcgcg
ggccaggccgggtgtcaccagctggccaacgcggcgagcgcccagcacagcacggcggag
gggaacccgggcagcgcgtggatggactaccccacaagcataacggacttgctcaataac
gaaaacatgattgacactttaggtaccggcaacaacggcgtaccgcaccaggagatcggc
gagttcgatgggtttatgtccacggacgatgagcggcttatttcaatatttaacagctaa

DBGET integrated database retrieval system