KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110168889Help
Entry
110168889         CDS       T05002                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04010  MAPK signaling pathway
bpec04210  Apoptosis
bpec04625  C-type lectin receptor signaling pathway
bpec04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110168889
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110168889
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110168889
   04672 Intestinal immune network for IgA production
    110168889
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110168889
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     110168889
Protein kinases [BR:bpec01001]
 Serine/threonine kinases: STE group
  Other
   110168889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal efThoc1 NARP1
Motif
Other DBs
NCBI-GeneID: 110168889
NCBI-ProteinID: XP_020790042
LinkDB All DBs
Position
Unknown
AA seq 888 aa AA seqDB search
MICNSHKVTPNFLRNFIVADAAIAHLATLTDESIRRLLIGSAVQGPINEMAVRQRIFNST
SPFSGTSQVELKGSFPVCTASEQDTEDEDEDGNNNKMNLIKYNPLLRRLWTYGTAEQIGE
GPLKTSSFIAQAECETQDSQEFSPSYSKCYVPSPNCFSNSHSSEPNNVASPAPASIQDLS
RSPAQSNSRKKARKKQKRKGKKKTEKKREERHRQRVPSGVPEQESGSSLPWMQEDSFSGC
SSGLSSSCCSSVECSEVQSPRSFYSKPVYNISSAVPWTGFVGSYRQESDSDSSSSIGDCS
LALAGLRGNVSQGDPCFAGPFFKELEQDVREQEEECTFYSDTNEGIIFYKEEIQTVDSEY
REGREYIFTDFIKEGSYGEVHTAKDVNTGFTFAAKKIALKRFNSEEVGAWSALKSSRVVE
LFGVVREGPNVVLFMDHKAGSLGQLISERGRLPEDLSLHYQCQVFCGLEYLVKKRVAHLD
IKADNVLLSVDGRDTFLCDFGHAERLDKQGHSLSRSRELKGTETHMAPEMVKGELRGAKA
DVWSSCCMFLHMLNGCQPWTRYYNCRLYLKIANEPPPLREIPSDCSPLTTDVFKAGLHKD
PVKRASASELKIKTARALQEVGGLTSSIKGPYIEPLYNVNKPPDNYLSNSVQETEELPKL
DKVWSVDKPKRGIGDDNLKSHQLDLDSEPCVQVPLIENIQKERNKTTTVPELELRKLERD
FYLSSLSQLHSAEMQEQLLSCISSDYSNRDQWEKKDSGRWSLSPGDDFSSGVFSCNSQPD
GQVFSMDFLGPSQFPPPSCFEGVDVCIKDISQRSIRIREARRVTVGHIATGISDQISERV
FTLETHTGQQIGHAEEVLESGLELCCVSAPDFSPTWRWRVKDGVLETR
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtaactcacacaaagtaacacccaacttcctgcgtaactttattgtggcggat
gcagccattgcgcacttggctactttgacagatgaatccatccgacgtcttctaattggg
agcgcggtacaaggtccaataaatgaaatggcggtgaggcagaggattttcaactccacg
tcccccttttctgggacgtcccaggtggagctgaaggggtcatttccagtctgtacagct
tcagagcaggatacagaagacgaggatgaagatggaaacaacaacaaaatgaacctgatc
aaatacaaccctttactgagaagactgtggacgtatgggaccgccgagcagataggagag
gggccactgaagacttccagcttcatcgctcaggctgaatgtgaaacccaggactctcaa
gaattcagtccatcctattcaaaatgctatgttccatctccaaactgcttctccaacagc
cattcttctgagccaaacaatgtagcctctccagctcctgcgtccatccaggatctgagc
aggtccccagctcaaagcaacagcagaaagaaagcacgcaagaagcagaagcgcaaaggc
aagaaaaaaacagagaagaagagagaagagagacatcgacagcgggtgccctctggggtc
cctgaacaagagagtgggagctctctgccgtggatgcaggaagattccttctctggctgc
agcagtggtctgagcagttcttgttgtagcagtgttgagtgctcggaggtacagagccca
cgttctttttacagtaaacctgtgtacaacattagctctgctgttccctggactggattc
gtggggtcttatagacaggagagtgactcagactcctccagcagcattggagactgctca
ttagctttagcaggtctcaggggcaacgtttcccaaggagacccatgtttcgctggacca
ttctttaaagagttagagcaggatgtaagagaacaagaagaagagtgcacattttactca
gatacaaatgagggaataatattttacaaagaggaaatacagacagtagattctgaatac
agagaggggagagagtacatcttcacagacttcatcaaagaaggctcctatggggaggtt
catacggcaaaagatgtgaacacaggtttcacgtttgcagccaaaaagattgctctgaag
aggttcaacagtgaggaggtgggtgcgtggagtgccctcaaatcctctcgtgttgtggag
ctgtttggagtggtcagagaagggcccaatgttgtccttttcatggaccataaagctggc
tctttggggcagctgatatcagagaggggacggctccctgaggatctaagtctccattac
cagtgtcaagtcttctgtggtttagagtatttagtgaagaaaagagtagcccatctggac
ataaaagctgataatgtgttactatcagttgatggtcgagacacttttctttgcgatttt
ggacacgcagaaagacttgataaacaaggacacagcctcagtagatccagagaattgaaa
ggtacagaaacgcacatggcccctgaaatggtgaaaggtgaactccgtggagctaaagca
gatgtgtggagcagctgctgtatgtttcttcacatgctcaatgggtgccaaccttggact
cggtactacaactgtagactgtacctcaagattgcaaacgagcccccacctttgagagag
atcccgtcagactgcagccctctcaccactgacgtgttcaaagccggtctacacaaggac
ccagtgaaaagagcatcagcgtctgaactgaaaataaaaacagccagagctttacaagaa
gtgggaggactcaccagctccatcaagggaccgtacattgaaccattgtacaatgtcaac
aaaccaccggacaactatttaagcaacagtgttcaggaaacagaggaactcccaaaactt
gataaagtgtggagtgtggataaaccaaagagaggaattggtgatgacaatctcaagtct
catcagttagacctggactcagaaccatgtgttcaagtccccttaattgaaaacattcag
aaagaaagaaacaagaccaccactgtgccagagctagagctacgtaaactggaaagagat
ttctacttgagcagcctatcacaactccattcagcagagatgcaggaacagttattgtct
tgtatcagcagcgactactccaatagagaccagtgggagaaaaaggactctggtcgctgg
tccctcagtccaggagatgacttcagctccggtgttttctcctgcaacagccaaccagat
ggacaggtgttcagcatggactttcttggcccgtcacaattcccaccaccctcttgtttc
gaaggagtagatgtgtgtatcaaagatatcagtcaaagaagtatccggatcagagaagcc
cggcgtgtgacagtgggacacatcgccacaggcatcagtgatcagatttccgagagggtt
tttaccttggagacacacacaggtcaacagattggtcatgctgaggaggtgctggagtct
ggacttgagctctgctgtgtctctgcacctgacttcagtcccacctggagatggagggtc
aaagatggcgttcttgagaccagataa

DBGET integrated database retrieval system