KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110169068Help
Entry
110169068         CDS       T05002                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpec01002]
    110169068 (tmprss2)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     110169068 (tmprss2)
Peptidases [BR:bpec01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110169068 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR SRCR Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 110169068
NCBI-ProteinID: XP_020790237
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MNNQVPVSPVYDNIGFRHDDERPPPYSPAQNLYPPIPRSTVPHSTPQYVPTNPYTINTHQ
TSILEVPQAQRKGIKCHWKYILCTSMCVFIIAAAVSLLLWYFLYYQCISGRSCGGKCLSL
SQWCDGVKDCPDEEDENQCFRFRGSNFLLESYSSASGSWLPVCADNFDNSHGKAVCEQMG
YERADYGSFTQTSAFSASGYLRLNLTINNGARMQAQLHHSYTCSSRAVALTCIGCGVSSA
APSSRIVGGTEAVNGAWPWQVSLQIRGQHVCGGSIISSMWILSAAHCFYSYNRAAMWRVQ
YGDISLSQMNSYHTPKSVEKIVSHENYNPDTNDNDIALLKLSSPLTFSSRVKPVCLPNIG
VNLSPVRQAWITGWGALRSSGSAPDIMNQAEVTIYHRETCNRPSVLDGAVTKTMICAGKL
SGGVDSCQGDSGGPLVVKQEGVWWLAGDTSWGIGCAWKNRPGVYGNVSYFINWVHEQMQN
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcaggtcccggtttctccagtctacgataacattgggtttcgacatgacgat
gaaagaccccctccatactccccagctcagaatctgtaccctcctatcccacgtagtact
gtcccacacagcactccacagtatgttcccaccaatccttacaccatcaacactcaccag
acttctatactagaagtaccccaggcacaaaggaaaggtataaaatgccactggaagtac
atcttatgtacatcaatgtgtgtgtttataatcgcagcagctgtttccctcttactttgg
tactttttgtattaccaatgtatctcagggaggtcttgtggcgggaagtgcctaagcctc
tcacagtggtgcgatggcgtaaaggactgccctgatgaagaagacgagaaccagtgtttc
cgatttcgaggctccaacttcctgctggaaagttactcatcagccagtgggtcatggctc
ccagtttgtgccgataactttgacaatagtcacgggaaggcagtgtgtgaacagatgggc
tatgagagggcggattatgggagtttcacccaaaccagtgccttttctgcttcaggatac
ctgaggctgaacctgaccattaataatggtgcacgaatgcaagcacagctccatcatagt
tatacctgttcatccagagctgttgcactcacttgtattggctgtggagtgagctcggct
gcacccagttctcgtattgtgggtggcactgaggcggtgaacggggcgtggccgtggcag
gtcagtctgcagatcagaggacagcatgtgtgtggaggctccatcattagctccatgtgg
atcctgtcagcggcgcactgcttttactcatataatcgagcagccatgtggcgggtacaa
tacggtgatatcagcttatcccagatgaatagttatcacacacccaagtccgtggaaaaa
atcgtcagccatgaaaactataacccggataccaatgacaatgacattgctcttctgaag
ctgagttcacctttgaccttttcatccagagttaaaccagtgtgtctgcccaacatcggg
gtaaatctgtcaccagtgcgacaagcctggatcacaggatggggagcactgcggtcatcg
ggatcggctcctgacataatgaaccaggctgaggtgactatttaccatagagaaacctgt
aacagaccctctgtactggatggggctgttacaaaaacaatgatctgtgctgggaaactg
tcgggaggagtggattcgtgccagggagacagtgggggccctctggtggtcaagcaggaa
ggtgtatggtggctggctggggacacgagctggggcattggctgtgcttggaaaaacaga
ccgggagtctatggcaatgtctcctattttattaactgggttcatgaacaaatgcagaat
aagtaa

DBGET integrated database retrieval system