KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110169262
Entry
110169262         CDS       T05002                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04068  FoxO signaling pathway
bpec04110  Cell cycle
bpec04115  p53 signaling pathway
bpec04218  Cellular senescence
bpec04310  Wnt signaling pathway
bpec04340  Hedgehog signaling pathway
bpec04371  Apelin signaling pathway
bpec04510  Focal adhesion
bpec04530  Tight junction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110169262 (ccnd1)
   04340 Hedgehog signaling pathway
    110169262 (ccnd1)
   04371 Apelin signaling pathway
    110169262 (ccnd1)
   04068 FoxO signaling pathway
    110169262 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110169262 (ccnd1)
   04115 p53 signaling pathway
    110169262 (ccnd1)
   04218 Cellular senescence
    110169262 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110169262 (ccnd1)
   04530 Tight junction
    110169262 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110169262
NCBI-ProteinID: XP_020790441
LinkDB
Position
Unknown
AA seq 294 aa
MEDQLLCCEVDSIRRAYQDGNLLNDRVLHTMLKAEESYLPSPNYFKCVQREIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVHPSELLQMELLLLNKLKWDLASVTPHDFIEHFLSKLKIHLSTKQVLRK
HAQTFVALCATDVNFIASPPSMVAAGSVAAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQQHHHSCTESKRVDGDVDLSCTPTDVRDVNI
NT seq 885 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgtgaggtggactccatcaggagagcctaccaggacggc
aacctgctcaatgaccgcgttcttcacaccatgctcaaggcggaggagagctacctcccg
tctccaaactacttcaagtgtgttcagagggaaattgtgcctaaaatgaggaaaatagtt
gccacatggatgttagaggtgtgcgaggagcagaaatgtgaagaggaggtttttccactg
gctatgaattatttggaccgatttttatcagtggaggccacaaggaaaacccgactgcag
ctacttggagctacctgtatgtttctggcctcaaagatgaaggagactgtacccttaaca
gcagagaaactgtgcatctacacagacaattctgtgcacccctccgaactgctgcaaatg
gagcttctgcttctcaacaaactcaagtgggacctggcctcagtcacaccgcacgacttc
atcgagcatttcctgtctaagctgaagatccacttgtccaccaaacaggtcctccgcaaa
catgctcaaacctttgtggccctctgtgctacagatgtgaacttcatcgctagccctccc
tcgatggttgctgctggcagtgtggcggctgcagtccaaggcctgtacctaaagagccag
gacgcctccttatcttctcagaacctcaccaacttcctgtcacaagtcatccgtagcgac
ccggactgtctgcgctcatgtcaagagcagatagagtctctattggagtccagtttgcga
caggcgcagcagcagcaccaccacagctgcacggagagtaaacgtgtggatggagacgtg
gacctgtcttgcacccccacagatgtacgggatgtaaacatctaa

DBGET integrated database retrieval system