KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110169421
Entry
110169421         CDS       T05002                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04012  ErbB signaling pathway
bpec04068  FoxO signaling pathway
bpec04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110169421 (cdkn1b)
   04068 FoxO signaling pathway
    110169421 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110169421 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110169421
NCBI-ProteinID: XP_020790621
LinkDB
Position
Unknown
AA seq 183 aa
MSDVRLSNGSPTLERTDSRVPDHPKPSACRNLFGSVDHEELKRDLKGHLREMEADASDKW
GFDFANNTPLSNSRLTWERVDCRTVPDFYSRQPHREKGVCSAGNNHVDLNGNHSCVVVSP
SEDRSDGQMECPEQCAGMRKRHACNEHSAQSKRSYSSTEEMSCPGLSRSTEHTPRKKSPK
RQT
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtcagatgtgcgtctttcaaatgggagccccacgttggagaggacggactcccgtgtg
ccggatcaccccaaaccgtctgcctgcaggaacctctttggctccgtggatcacgaagag
ttaaagagggatttaaagggacatttgcgggagatggaagcggatgcctctgacaagtgg
ggcttcgacttcgcaaataacacgccgctttcaaacagtcggctaacctgggagcgggtg
gattgtagaacggtcccggatttctacagcaggcagccgcatagggagaagggcgtttgc
tccgctgggaataaccatgtggatttgaatgggaatcatagctgtgttgttgtgagcccg
agcgaagacaggtctgacgggcagatggagtgcccggagcaatgtgcaggaatgagaaag
agacacgcatgcaacgaacattcggcccaaagcaagaggtcgtacagcagcaccgaggag
atgagctgtcccggtctgagccgctcaacagagcacacacccagaaagaagagtcccaaa
aggcaaacgtaa

DBGET integrated database retrieval system