KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110170398Help
Entry
110170398         CDS       T05002                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110170398
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     110170398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core Fer4_14
Motif
Other DBs
NCBI-GeneID: 110170398
NCBI-ProteinID: XP_020791703
LinkDB All DBs
Position
Unknown
AA seq 784 aa AA seqDB search
MPGERLSVRSMSDVGRFPGAAPPTRVQLTIHKEEKKPEEAGCKRWFKKMCPCCFKRQSST
SYDVTDKVELVKPPTPAPITPEPEKLKTEKVEMKEMDEFKLSVCSVDLLSSQTDPNRKEH
HTDLFHGDELIIRRGQTFQIQVELNRPYCADTDKLHLELKTGGLPLVSKGTHVIIPLVDD
LEDECWEAKIVEQTENKIKLSVNSPASAVVGLYGVSVVTSSLKGNSPTTYNSPKHIVMLF
NPWCEEDTVFLDDEDERKEYVLNDTGRIYYGTEKQIGARTWNFGQFHEGMLEACLFILEK
SDMPPSGRGDPVNVVRVISAMINAQDDHGVLVGNWSGDYSDGVSPAAWSSSVEILKKYHS
SYGTPVCYGQCWVFSGVTTTVLRCLGIPARSVTNFQSAHDTDVSLTTDVYFDENLEPIDY
LNKDSVWNFHVWNDCWMARPDLPPGNGGWQAVDSTPQETSQGTFRCGPASINAIRTGHVY
LKHDTPFVFAEVNSDKIYWQRNLDGTFSQIYSEKKAVGHFISTKAVGSDERADITHLYKH
QEGSEEERIAVETASRYGSKPDVYSAPSAEDVSVEVKMAGEGPRMGADAQLTIVVKNLST
KPRQTTLHSQVAVMYYTGVLKGTIKKEQMSVELQPNEEKTIDWVLPYQQYQNQLVDQAAL
MLTLSGRVNETQQVLANQTTFRLRTPDLTITPLGEAVVGKEMAAKITFTNPLPKTLKDVV
FRVEGLGLQKGHVVVVGDVGGLATVTLTEHFIPTQPGLKKLVASLDCKQLTQVHGVADIV
VLEQ
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccaggagagcgtctgtcagtgaggagcatgtcagatgtgggtcggtttcctggagcg
gcgccccccacccgcgtgcagctcaccatccacaaagaggagaagaagccagaggaagca
ggctgcaaacgctggtttaagaagatgtgcccatgctgtttcaaaaggcagtccagcact
tcatatgacgtcacagataaagtggagttggtcaaaccccctacccctgccccaatcacc
cctgaaccagaaaaactcaagactgaaaaagttgaaatgaaggaaatggatgaatttaag
ttgtctgtgtgttccgtggacctgctgagctctcaaacagatccgaacaggaaggaacac
cacacggacttgttccatggagatgagctgatcatccgcagaggacagactttccagatc
caagtggagctcaaccggccttactgcgctgacaccgacaaactgcacctagaactcaaa
acaggggggctgccactggtgtccaaaggcacacatgtcatcattcctctagtagatgac
ctggaggatgagtgctgggaagccaaaattgtggagcagactgaaaacaaaatcaagctg
tcagtcaactctccagcctccgcagtggtgggcctgtatggggtctctgtggtcaccagc
tcactcaaagggaacagccccaccacctacaactcacccaagcacattgtgatgctgttt
aacccatggtgtgaagaggacacagtgttcctggatgatgaggatgagaggaaagaatat
gtgctcaatgatactgggcggatttactacggaacagagaaacaaatcggcgcccgcacg
tggaattttgggcagtttcatgaagggatgcttgaggcctgcctgttcattctggagaaa
agtgacatgcctccctctggtcgtggtgatccagtcaatgtggtccgagttatatctgcc
atgataaatgctcaggacgaccatggtgttttggtggggaactggtcaggggactattca
gatggtgtgtccccagctgcgtggagcagcagtgttgagatcctgaagaaataccactct
tcctatggcacacctgtgtgttatggacaatgttgggtcttttcaggggtcacaacgaca
gtgttgcgttgtcttggcatacctgcccgcagtgtgaccaacttccaatcagctcatgat
acagatgtgtcactcaccacagatgtgtattttgatgagaatctggaacctatcgactac
ctcaacaaagactctgtttggaacttccatgtgtggaacgactgctggatggccagacca
gacctgcctccaggtaatggaggctggcaggcagtggactccactccccaggagaccagt
cagggcaccttccgctgtggtccagcctctatcaacgccattcgcacaggacatgtctac
ctcaagcacgacactccctttgtgtttgcagaggtcaacagcgacaagatctactggcag
aggaacttggacgggactttcagccaaatttacagtgagaagaaagcagtgggccacttc
atcagcactaaagccgtgggctcagacgagcgtgcagacatcacacacctgtataaacac
caggaaggttcagaagaggaacgcattgcagtggaaacagccagccgctatggcagcaag
ccagatgtgtactctgctccaagtgctgaagacgtgagtgtggaggtcaagatggccggg
gaaggacccaggatgggagcggacgcccagctcaccattgtagtgaagaacctgagtaca
aaaccacgccagaccacgctgcacagccaggtggcagtcatgtactacactggtgtgctc
aagggcaccattaagaaggagcagatgtcagtggagctccagcccaatgaagagaaaacc
attgactgggtgctcccataccaacaataccagaaccagcttgtggaccaggcggccctg
atgctgaccctctctggacgagtcaatgaaactcagcaggtgttggctaaccagaccacc
ttcaggctccgcacacctgacctgacaatcactccacttggtgaagctgtggttggtaag
gagatggcagccaaaatcacattcaccaacccactgccaaaaactctgaaggatgtggtg
ttcagagtggagggcctgggtctacagaagggtcacgtggtggttgtgggggatgtagga
ggccttgctacagtgacactgacagagcacttcatccccactcagcccggactcaagaag
ctggtggcatctctggattgtaaacagctcacccaggtccatggagtggctgatattgtt
gtccttgaacaatag

DBGET integrated database retrieval system