KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110171174Help
Entry
110171174         CDS       T05002                                 

Definition
(RefSeq) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00100  Steroid biosynthesis
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110171174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bpec00199]
    110171174
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     110171174
Cytochrome P450 [BR:bpec00199]
 Cytochrome P450, animal type
  CYP24 family
   110171174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Spermine_synth
Motif
Other DBs
NCBI-GeneID: 110171174
NCBI-ProteinID: XP_020792522
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MRAQIQKVPQIVELLKKKSVGLQHFKPTSSVCVLEEKDAVETAPLCPHAASRAHAAHSLD
AIPGPTNWPLVGSLVELLRKGGLTRQHEALVDYHKKFGKIFRLKLGSFESVHIGAPCLLE
ALYRKEGNYPQRLEIKPWKAYRDLRNEAYGLLILEGKDWQRVRSAFQHKLMKPTEVVKLD
NKINQVLVDFVGRIKNINKNGKIEDLYFELNKWSFETICLVLYDKRFGLLQEKVNEEAMN
FITAVKTMMSTFGMMMVTPVELHRSLNTKTWQDHTAAWDRIFSTAKVYIDKKMKRNTNRA
PDDLIGDILHHSCLSKKELYAAITELQIGGVETTANSMLWAIFNLSRNPGAQRKLLEEIR
AVVPPDQDPCGEHIKSMPYLKACLKESMRLSPSVPFTSRTLDKDTVLGDYAIPKGTVLMI
NSHALGSNEAYFDDTKQFKPERWLRETSTINPFAYVPFGIGKRMCIGRRLAELQLQLAMC
WLVRDFEIVATDNEPLDVIHSGLLVPNRELPVAFIRR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgcaaatacagaaggttccccagatagtggagctgctgaaaaagaagtcagtg
ggactgcagcattttaagcccacgtcctcagtgtgtgtgctggaggagaaggatgctgtg
gagacagcgccgctctgccctcatgcagcctccagagcgcatgctgcgcacagcctggat
gccattcctggtcctaccaattggcccctagttggcagtctggtagaacttctgcgtaaa
ggagggctcactaggcaacacgaggctctggttgattaccacaagaaatttggtaagatt
ttccgattgaaactgggctcctttgagtcagtgcacattggtgcgccttgtttgctggag
gcgctctatcggaaggagggcaattaccctcagagactggagatcaagccgtggaaagct
tacagagacctaagaaacgaggcatacggactcctcattctagaggggaaagactggcaa
agagtgaggagcgcgttccagcacaagctcatgaagcccacagaggtggtgaaacttgac
aacaaaatcaaccaggtgttggtggattttgttggaagaattaaaaatattaacaagaat
ggaaaaattgaggatttgtacttcgagctgaataaatggtcatttgaaacgatttgcctg
gttctgtatgacaagaggtttggtcttttgcaagagaaagtcaacgaggaagctatgaac
ttcatcacagcagtgaagacaatgatgagcacttttggcatgatgatggtgacaccagtg
gagcttcacaggagtctcaacactaaaacatggcaggatcacacagcagcttgggaccgc
attttcagcaccgccaaagtctacatcgacaagaaaatgaagaggaacacaaaccgagca
cctgatgacttaattggtgacatcttacatcacagctgtctttccaaaaaggagctgtat
gctgccatcactgagctccagatcggaggagtagagacgaccgccaacagtatgctgtgg
gctattttcaacctgtcacgtaaccctggcgcccagagaaagctgctggaggagatccga
gctgtggtgcccccagaccaagacccatgtggagagcacatcaaaagcatgccctacctc
aaggcctgtctcaaggagtccatgaggttgtcgccatcagtcccattcacaagcaggact
ctggacaaagacactgtgttgggagattatgccattcccaaaggaacagttttaatgatt
aacagtcatgcactgggctccaatgaagcgtactttgatgataccaaacagttcaagcct
gagcgatggctgcgggagactagcaccatcaacccttttgcctatgtgccctttggcatt
ggaaagaggatgtgtattggacgaagactagccgaactacagctgcagctagcaatgtgt
tggctggtacgagacttcgagattgtggcaactgataatgagcccctggatgtgatccac
tctggacttttagttcccaacagagagctgcctgttgcctttatcaggagatga

DBGET integrated database retrieval system