KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110171817Help
Entry
110171817         CDS       T05002                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110171817
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpec01002]
    110171817
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpec04147]
    110171817
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     110171817
Peptidases [BR:bpec01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110171817
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110171817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 110171817
NCBI-ProteinID: XP_020793267
LinkDB All DBs
Position
Unknown
AA seq 245 aa AA seqDB search
MKAFILLALFAAAYAAPIEDDKIVGGYECRKNGVRYQVSLYSGYHFCGGSLITSSWVVSA
AHCYKSRIEVRLGEHNIAVNEGTEQFISSSKVIKHPNYDSYTLDNDIMLIKLSKPATLNS
YVGTVSLPSSCASAGTTCLISGWGNTSASGSNYPDRLMCLDAPILSDSSCRNSYPGEITS
NMFCAGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKNRPGVYAKVCNYNTWIRN
TMSSN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcattcttctggctctctttgctgcggcttatgccgctcccattgaggat
gacaaaattgtcgggggatacgagtgcaggaagaacggcgtgcgctatcaggtgtctctg
tattctgggtatcatttctgcggaggctccctgatcaccagcagctgggtagtgtctgct
gctcactgctacaagtcccgcattgaggtgcgtcttggtgagcacaacattgcagtcaac
gaaggcactgagcagttcatcagctcttccaaagttatcaagcatcctaactacgacagc
tatactctggacaacgacatcatgctcatcaagctgagcaagcccgccaccctgaacagc
tacgtgggaactgtgtccctgccctccagctgcgcctctgccggaaccacgtgtctcatc
tctggatggggcaacacaagcgcctctggaagcaactaccctgaccgtctgatgtgcctg
gatgcccccatcttgagtgacagcagctgcagaaactcctaccctggagagatcacctcc
aacatgttctgtgctggattcctggagggaggcaaggactcctgccagggtgactctggt
ggccctgtcgtgtgcaacggtcagctgcagggagtggtgtcctggggctatggctgcgcc
cagaagaacagacctggtgtctacgccaaggtctgcaactacaacacctggattcgcaac
accatgagctccaactaa

DBGET integrated database retrieval system