KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110172564Help
Entry
110172564         CDS       T05002                                 

Definition
(RefSeq) low-density lipoprotein receptor-like
  KO
K12473  low-density lipoprotein receptor
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110172564
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bpec04131]
    110172564
Membrane trafficking [BR:bpec04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110172564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL DUF5050 TMEM154 DUF4448 MID_MedPIWI AJAP1_PANP_C hEGF
Motif
Other DBs
NCBI-GeneID: 110172564
NCBI-ProteinID: XP_020794108
LinkDB All DBs
Position
Unknown
AA seq 871 aa AA seqDB search
MFRTRRGLGTLALCCCLVMLLQSVADAANTCRANQLQCDNGRCITIKWICDGRDDCGDGT
DERPATCANKTCSQSEFNCGPPMNQCIPGGWHCDGQADCKNGADEEHCSAKKCKDSEFKC
ANGQCISNSFVCDKEADCSDGSDEVSCPKPTCGPNSFQCNNSVCVPLLWRCDGDADCADG
SDEWPQTCAGQDVAKPAQCGSHQFQCDDGKCIHRIWRCDNSPDCDDESDEVNCTRPACHL
DEFQCTDGTCIHGSRQCNRVFDCSDQSDEAGCDIENDCEGPTKFKCKNGECISADKVCDS
NTDCKDGSDETTECGLNECSDGNGGCSQICNDLSLGFNCSCATGYRLKADKKTCEDIDEC
AMPDTCSQICINFDGGYRCDCKQGYEIDPATGTCKAGSGSAPMLYFTSRHELRVMTVDRS
EYIRLIPELKNAVALDVNIPTKTIFWSDLSLKKIYSTNVDTAGNSSTHTVVIGSGIEAPE
GIAVDWIHGNIYWTDSELKTISVATTDGSKRKSLISENLEKPRAITVDPVNNFMYWTDWG
EQAKIEKSGLNGADRVAIVTDNIMWPNGITLDMVNQRLYWVDSKMHTLSSVDVSGGSRHT
LVVSEKHLTHPVSLAVFEEKVFWTDTGNGAVYSANRLTGGDITELAKDLNHPEDIIVYHK
LKQTNGTNWCQMNSSRNGGCEFLCLPAPRINSRSPQYTCACPDHMTLAAGNRKCVGPVNP
PVTTAAPPAKVPTTQAPPQPTTTTTTTTTTTTTSTTTTSTAAPPQTTTSKTPKLLATEHV
NNKLSGTPTEDESSHPIAVYIVVPILVMSLLIFGAVLLWRNWRLKNTNTIHFVNPVYQKT
TEDEVHICQNTSQGYVYPERTMLSMEDMDVA
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggacgcggagaggacttggcacgctcgccctttgctgctgcctggtgatgctg
ttacagagtgtggcagatgctgcaaacacctgccgtgctaaccagctgcagtgtgataat
gggaggtgtatcaccatcaagtggatctgtgacggaagagacgactgtggagacggcact
gacgagaggccagccacatgtgcaaacaagacttgttcacaatcagagttcaattgtggc
cctcccatgaaccagtgtataccaggtggctggcactgtgatggtcaggccgactgcaag
aacggagctgatgaggaacactgctctgccaaaaagtgcaaggacagtgagttcaaatgc
gcaaacggccagtgcatatcaaattcatttgtgtgtgacaaagaagcagattgcagtgac
ggttcagatgaggtctcctgtcccaaacccacatgtggcccgaactccttccagtgtaac
aactcagtgtgtgtcccgttgctatggcgatgtgatggggatgcagactgtgccgatggg
tccgatgagtggccccaaacatgtgcaggacaagacgtggcgaagccagcacagtgcggc
tcacaccagttccagtgtgatgatgggaaatgcattcacagaatatggcgctgtgacaac
agcccagactgtgacgatgaatctgacgaggttaattgcactcggcccgcctgtcacctg
gatgagttccagtgcactgatggtacatgtatccatggcagccgtcagtgtaaccgagtg
ttcgactgcagcgaccaaagtgatgaagctggctgtgatatagaaaatgactgtgagggc
cccaccaagtttaaatgtaaaaatggggagtgcatcagtgcggacaaagtgtgtgactca
aacaccgactgcaaggatgggtccgatgaaacaactgaatgtggtttaaatgaatgctct
gatggaaatggtggctgttcccaaatatgcaacgatttgagtcttggattcaactgttcc
tgtgcaacaggatacagactaaaggcagataagaagacatgtgaagatattgacgagtgc
gctatgccagacacttgtagtcaaatctgtatcaactttgacggtggctacagatgtgac
tgtaagcagggctatgagatcgaccccgcgacaggcacatgcaaagctgggtcaggatct
gcccccatgttgtacttcaccagcagacatgagctgagggtgatgacagtggaccgcagt
gaatacatacgcctcatcccagaactcaagaatgcagtcgctctggatgtgaacatacca
acaaagaccatcttttggtccgatctctctctaaaaaagatatacagcacaaatgtagat
actgcgggtaactcctccacccacactgtagtgattgggagtgggattgaagccccagag
ggaattgcagtagactggatccatgggaacatttactggacggacagtgagctgaaaact
atttccgtggcaacaactgacggaagcaagagaaagtccctgatctctgaaaatttagaa
aagcccagagccatcacagtggaccctgtcaataacttcatgtactggacggactggggt
gagcaagctaaaattgagaagagtggactgaatggtgctgaccgcgttgccatagtgacg
gacaatattatgtggcccaatggcatcactcttgacatggttaatcagcgcttgtattgg
gtcgactccaagatgcacactctctccagtgtagatgtcagcggaggctcccggcataca
cttgttgtcagtgagaagcacctcacccatcccgtgtctctggcagtttttgaggagaaa
gtgttctggactgacactggaaacggtgctgtctacagtgccaatcgtttgactggtgga
gacatcacagagctggccaaagatctgaaccatcccgaagacattattgtgtatcacaag
ctcaagcagaccaacggaacaaactggtgccaaatgaacagcagcagaaatggaggctgt
gagttcctctgtctccctgcccctcgcattaacagccgctccccccagtacacatgtgca
tgtcctgatcacatgaccttggctgccggtaacaggaagtgtgttggtccagttaaccct
cctgtgaccaccgctgcaccaccagctaaagtgcccaccactcaagctccacctcagcct
actactactactactactacaaccacaaccacaactacttctacaactactacttcaact
gcagctccaccgcaaactacaacttcaaagacacctaagctactcgcaactgaacacgtg
aataacaaattgtctggaacgcccactgaagatgagtcctcccatcctattgctgtttac
attgttgtacccattttggtcatgtcactgttaatctttggtgctgtgttgctgtggaga
aactggcgtctaaagaacaccaatactatccacttcgtcaacccagtgtatcagaaaact
accgaggacgaggtgcacatttgtcaaaacacttcacagggctacgtctatcccgagagg
acaatgctgagtatggaagacatggatgttgcgtga

DBGET integrated database retrieval system