KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110172979Help
Entry
110172979         CDS       T05002                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpec01001]
    110172979 (mapk6)
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110172979 (mapk6)
Protein kinases [BR:bpec01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110172979 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH LELP1 Ole-e-6
Motif
Other DBs
NCBI-GeneID: 110172979
NCBI-ProteinID: XP_020794613
LinkDB All DBs
Position
Unknown
AA seq 698 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPNGRRLTEDVVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIRNDMSTPHNPLKTLLPEVSPQALDFLEKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPISLHPFHIEDEVDDILLMDQSHSHTWDRYHDSQL
SEADWNLRSTHDPEEVQVDPRGLSDVTDEEEVQVDPRKYTDSEREKFLDEPSFDYSMFSA
ERSWSDEHHENKYCDLQCSHTCNYKAVSPSYLDNLVWRDSEVNHYYEPKLIMDLSNWKEQ
SKEKTKSKTKCEKNGLVKMALQQQSVSEKDREQEKHQAPQNQGFDFDSFIASTIKLSLQP
EPCPEVALLSQVGLLNELNTSVSQLEAPRSGSMSKSISQEKEEKCLVNLAQLGDAVWPAF
GCGEPVDHRSEGGYTSYLDQLFGRKEECPAETLACSDAELHEEAFLGCGTEIVLNMQLDS
LAEDLPLKSIQASLSPCTVKCSPQIAHKTYSSIFKHLN
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagtttgagtctttaatgaacatccatgggtttgacctgggttcccgttac
atggacttgaagccgctggggtacggagggaatggtctggtcttctctgctgtggatacg
gactgtgacaaacgcgtcgcggtgaagaaaatcatcctgacagacccccaaagtgtaaaa
cacgccctcagagaaatcaagatcatccgacggctcgaccacgataatatcgtcaaggtg
tttgagaccctggggccaaatggtcgcaggctcacagaggacgtggtgtcgctgacggag
gtgaactctgtgtacatcgttcaggagtacatggagaccgacctgtgccagctgctggag
agggggctcctgtcagaggaccacgcccgcctgttcatgtaccagctcctcagggggctc
aagtacatccactctgccaacgtgctgcaccgagacctcaaacccgccaacctcttcgtc
aacacggaagacctggtgctcaagatcggggactttggactggccagaattatggaccca
cactactctcataaggggcatctctctgaaggtttggtcacaaagtggtacagatcacct
cgcctccttctctctccaaacaactacaccaaagccatcgacatgtgggcggctggctgc
atattcgctgaaatgctcaccggaaaaaccctcttcgcaggggcccatgagctggagcag
atgcagctgatcctggagtcgatcccggtgctgagggaggaggaccgtcaggagttgcac
agtgtgatccctgtgttcatccggaacgacatgtccacgccccataaccctctgaagact
ctgctgcccgaagtcagcccccaagcgctggatttcctggagaaaatcttgacctttaac
cccatggaccgtctgaccgcggaggaggctctggcccacccgtacatgtctgactactcc
ttcccgctggacgagcccatctcgctgcaccccttccacatcgaggacgaggttgatgac
atcctgctcatggaccagagccacagccacacatgggacaggtatcatgatagtcagtta
tctgaggctgactggaacctgcgtagcacccacgaccctgaagaggtgcaggtggatccc
agagggctgtctgatgtcacagacgaggaggaggtccaggtggaccctcgtaaatacact
gacagtgagcgggagaagttcctggacgagccgtcctttgattactccatgttctcagct
gaacgctcgtggtctgacgaacaccatgagaacaagtactgtgacctgcagtgcagccac
acctgcaactacaaggccgtgtccccctcctacctggacaacctggtgtggagggacagt
gaggtcaaccactactacgaacccaaactcatcatggacctatccaactggaaggagcag
agcaaagagaagaccaagtccaagaccaagtgtgagaagaacggtctggtgaaaatggct
ctgcagcagcagagtgtctctgagaaggatcgtgagcaggagaagcaccaagccccacaa
aaccagggctttgactttgactcattcatcgccagcaccatcaaactcagcctgcagcct
gagccctgtccagaggtggcgctgctgagccaggtgggtctcctgaatgagctgaacacc
tctgtgtctcagctggaggctcctcgctccggatccatgtccaagtccatcagtcaggag
aaggaggagaagtgcctggtgaacctggcccagctcggtgacgccgtgtggcccgccttc
ggctgtggtgagccggtggaccacaggtcggagggaggctacaccagttacctggaccag
ctgtttgggcgaaaggaggagtgtcccgcagagactctggcctgctctgacgcagagctg
catgaggaggccttcctgggctgtgggacggagatcgtcctgaacatgcagctggactct
ctggctgaagacctccccctcaagtccatccaggcctctctgtccccctgcaccgtcaag
tgctcgcctcaaatcgcccataaaacctacagcagcatcttcaaacacctgaattaa

DBGET integrated database retrieval system