KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110174480Help
Entry
110174480         CDS       T05002                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00052  Galactose metabolism
bpec00500  Starch and sucrose metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110174480
   00500 Starch and sucrose metabolism
    110174480
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     110174480
    3.2.1.20  alpha-glucosidase
     110174480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110174480
NCBI-ProteinID: XP_020796241
LinkDB All DBs
Position
Unknown
AA seq 1809 aa AA seqDB search
MIDCSYNCNVWICFMCWILWSNADIVSVLPGGAITIVPQCPNIPLGNRVDCHPNAGASKQ
LCEARGCCWSPLDERNVPWCFFSSNHGYTVTSTDPSNPNALKATLKRKTAPSLFGGDIQE
LALHAEMQTPKRLHFKIYDPQQKRFEVPHDHIRGLNAQPSSPISDTMEITHDSFGIIVRR
KENKKVLFDTTMAPLVFADQYLQISAKLPSHNIYGLGEHVHQNFRHDTNWRTWPIFTRDA
FPNGGTHNLYGHYPFFLCLEDESGKSFGVFLLNSNAMEVTLQPAPAVTYRTIGGVLDFYI
VFGDTPEQVVQEFLELIGRPVIPAYWSLGFQLSRWDYGSLSEVKATVERNRAVQIPYDIQ
YTDIDYMEDKKIFTYDKVKFAELPQFADYLHEKGQRYILILDPAVATSKRVGNASYEAFD
RGTAANAWVFTADGKTPLLGEVWPGETVFPDYTSQACIDWWVDEYERLYREIKHDALWID
MNEVASFVKGSSKGCVDNNLNYPPYTPRILDEVMFSKTLCMDAKQAWGNHYDVHSLYGYS
MVLATEKALQRVFGENRTLMLTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFSLF
GIPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAQGYRPQDPAWYGADSTLVRSS
KHYLTIRYTLLPYLYTLFYKAHTTGETVVRPMMHEFYSDSATWTIDRQFLWGKGLLITPV
LDPGTDTIRAYVPDAVWYDYDTMEGITPRRQFVDMYIPGDKMGLHIRGGAILPTQQPAVT
TTYSRTNPMGLIVALDDNSQATGELFWDDGDTRATVETGKYIHYQFSVLYRILTLQATHV
GYTDPNNLKFDDITILGVPLTPSSVTVVNTKTSEVTQVPSANIQHDKTKKVLFLRRLGLT
LGESYTVEWNQPVAEFERFDCHPEENADQAKCQARGCIWEPSNSDKVPWCFYPNDYGYTY
TSFTQTESGMTLDISRNTKHRSTNRAGSPDINNLRVEIFYLSSDMLRFKIWDPTTKRYEV
PVPLNVPATPETDESKRMYRVELINNPFGIRVIRKSTGTTIWDSSLPGFTFSDLFIQVST
RLSSDFVYGFGETEHPTYRHNLYYHTWGMFAKDQPPGYKMNCYGVHPFYMGLENTADAHG
VLLLNSNAMDVTFQPTPAITYRTLGGILDFFMVMGPTPEMVVQEYTALIGRPVLPAYWSL
GFQLCRYGYANDAEIRDLYNDMKAAKIPYDVQYGDIDYMERQMDFLLDEVNFKGLPALVD
SMRAEGMRFIFILDPAIAGNETQPYPAFTNGLAQDVFIKWPKELSNDIVWGKVWPDLPNV
TVDNSLDWDTQVRLFRAYTAFPDFFRTSTAQWWQKEIKDFYNNVMKFDGLWIDMNEPASF
VHGTVDGNCLGDPLLENPPYMPPLESKHMGLNHKTLCMNSEQILPDGTHVRHYDVHNLYG
WSHAKPSYDALLATTGKRGIVVTRSTYPSSGQWAGHWLGDNFASWDQLYKSIIGMMEFSL
FGIPYTGADICGFFNPSEYELCLRWMQLGAFYPYSRNHNGLGNPRQDPVAWDEFFANASR
DALNIRYTLLPYLYTLMYEAHTKGSTVIRPLLHEFVSDKNTWDIHTQFLWGPAFLITPAL
DMGVREVRGYVPRDRWYDYHTARDVGVRGQTVVMPTPLDHINLHVRGGYILPWQRPELNT
KLSRTNPLGLIVALSDSNTAQGSFFWDDGESIDTAERNEYLFTSFSVQSNNLTNNPIHTG
LNPADRLMMGVVKIWGAGSVQITQATLTDFSGTPSLLTVQHNLDTQELIIDVTAKNQRVD
QPFSISWRS
NT seq 5430 nt NT seq  +upstreamnt  +downstreamnt
atgatagactgcagttataattgcaatgtgtggatttgctttatgtgttggattttgtgg
tcaaatgcagacattgtttctgttttaccaggaggcgccatcaccatcgttcctcagtgt
ccaaatatccccctggggaaccgagtggactgccatcctaacgccggagcctccaagcaa
ctatgtgaagcgcgtggctgctgctggagccctctggatgagaggaatgtcccctggtgc
ttcttctcctcaaatcacggatacacggtgacatcaacggatccctccaatcctaatgca
ttgaaagccactcttaaaaggaagaccgctccatctttgtttgggggagatattcaggag
ctggctcttcatgcagaaatgcagacacccaagcgccttcattttaagatctatgacccc
cagcagaagcggttcgaggtcccccatgatcacatccgcgggctgaatgctcagccatcc
agccccatcagcgacaccatggagatcacacacgactcctttggcattattgtgcgcagg
aaggagaacaagaaagtcctgtttgacaccaccatggccccgctggtgtttgcagatcag
tacctccagatatcagccaagctgccatcccataatatttacggcctaggggagcacgta
caccagaatttccgccatgacaccaactggaggacctggcccattttcaccagagatgct
tttcccaatgggggaacacacaacctctacggacactatcccttcttcctctgtctggaa
gatgagagcggaaagtcattcggggtcttcctcttaaacagcaatgcaatggaggtgacc
ttgcagcccgccccagcagtcacctacaggaccattggaggagttctggacttctacatc
gtctttggggatacaccagaacaagtggtgcaggagttccttgaactcattggcaggcct
gtcatccccgcctactggtcactgggcttccagctctcacgctgggactatggcagcctg
agtgaagtcaaagctaccgtggagaggaaccgtgctgtgcagattccatatgacatccag
tacactgacattgactacatggaggacaagaagatctttacctacgataaagtcaagttt
gctgagctgccccagttcgccgactaccttcacgagaaaggacagagatacattctcatc
ctggaccctgccgtagccaccagtaagagggttggaaacgcatcctatgaagcgtttgac
cgtggaacagcagctaatgcctgggtctttaccgccgatgggaaaactcctcttttggga
gaggtgtggccaggagagacagttttccctgactacaccagccaagcctgcatcgactgg
tgggtggatgagtacgagaggctttaccgcgagatcaagcacgatgccctctggattgac
atgaatgaagttgcaagtttcgtgaaaggatcaagcaaaggctgtgtggacaacaacctc
aactaccctccatacacgccaagaatcctggacgaggtgatgttcagtaagaccttgtgt
atggatgccaagcaggcctgggggaatcactatgatgttcacagcctctacgggtactcc
atggtgctggccacagagaaagcgctccagcgtgtgttcggagagaaccggaccctcatg
ctgacccgctcctccttcccaggtgtgggcaagtactcgggtcactggctcggagacaac
ggtgccaactggaatgacatcaaatgggctatccccggcatgctggagtttagccttttc
ggaattccttatatcggggctgacatctgtgggttctttgacgacagcagtgaggagctc
tgccgccgatggatgcaagtgggagccttctacccattctcccgaaaccacaacgctcaa
ggctaccgcccccaggatcctgcttggtacggggccgattccaccctggtgaggagctcc
aagcactacctgaccatccgctacactctgctgccatatctgtacacgctcttctacaaa
gcccacactacaggggagacggtggtgcgccccatgatgcacgagttctactcagacagc
gctacatggacaatagacagacagttcctgtggggaaagggtcttcttatcacccctgtc
ctggacccggggacagatacaattcgggcatacgtcccagatgcagtgtggtacgattat
gatacgatggagggaattacacctcgcaggcagtttgttgacatgtacatccctggagac
aaaatgggcttgcacatcagaggaggagccattcttcccacacaacagccagcagtcacc
actacatacagtcgcaccaaccccatgggcctgatcgtggctctcgacgacaacagccag
gccacaggggagctattctgggacgacggagacacgcgcgcaacggtggaaacaggaaaa
tacatccactaccagttttcagttctctatagaattctcacacttcaagccacccatgtt
ggctacacagacccaaacaacctgaaattcgatgacataaccatcctgggtgtaccactg
actccatcgagcgtcactgtcgtaaatactaagactagtgaggtcactcaggtgccctct
gccaacatccagcatgacaaaaccaagaaggttttgttcctgcgccgcctgggcctaaca
ctgggcgagtcctacactgtcgagtggaaccagccagtagccgagttcgagcgcttcgac
tgccatcctgaagagaacgcagatcaggctaagtgccaggccagaggctgcatctgggag
ccaagcaatagtgacaaggtcccatggtgcttctatcctaatgactatggatacacatac
accagctttactcagacagaatcaggtatgactctggacatcagtaggaatacaaagcac
agaagcacgaaccgcgcaggctcacccgacatcaacaacctacgagtcgaaatcttctat
ctctcaagtgacatgttgcgctttaagatttgggatccaactacaaaacgctatgaagtc
cctgtaccactaaatgtaccagctacacctgagactgatgagagcaagaggatgtacagg
gttgaactcatcaataatccatttggcattcgagttattaggaagagcacaggaaccacc
atctgggactcgtcactgcctggttttaccttctccgacctgttcatccaagtgtccacc
aggctgtcgtcagactttgtctatggctttggagagacagaacaccccacctacagacac
aacctctactaccacacctggggcatgttcgccaaggaccagccaccgggctacaagatg
aattgctatggagtgcatcccttctatatgggcctggagaacacagctgacgctcacggt
gttcttcttctcaacagtaacgccatggacgtgactttccagcccactcctgctataacc
taccgaacactgggaggcatcctggacttcttcatggttatgggccccactccggagatg
gtggtgcaggagtatactgcgctgattggacggcccgtgctgcccgcatattggtcactt
ggcttccagctctgtcgctatggttacgccaacgacgcagagatcagagatttgtacaat
gacatgaaagcggctaagataccatatgatgtgcaatacggtgacattgactacatggaa
cgtcagatggacttcctcttagatgaagtgaatttcaaaggactcccagcactggtcgat
tcaatgagagcagagggaatgcgctttatcttcattctggatccagccattgcgggcaat
gaaactcagccttatcctgcttttaccaatggtcttgctcaagatgtttttatcaagtgg
ccaaaagaactcagtaatgacattgtatggggaaaggtatggccagacttaccaaatgtc
actgtagataactccttggactgggacactcaagttaggttattcagagcctatacagca
ttccccgacttcttccgcacttcaaccgcccagtggtggcaaaaagaaattaaagatttt
tacaataatgtcatgaagtttgatggactctggattgacatgaatgagcctgccagtttt
gtccacggcacagttgatggaaattgtcttggtgatcctctcctggagaatccgccatat
atgccacctctggagtccaaacatatgggcttgaaccacaagaccctgtgcatgaacagt
gagcagatcctccccgacgggacacacgtcaggcactacgatgtgcacaacctttatggc
tggtcccacgccaaaccctcctatgacgccctgctggccaccacaggtaaaagaggcatc
gtggtgacccgctccacctacccctccagcgggcagtgggctggacactggctgggagac
aacttcgccagctgggaccaactctataaatccatcataggcatgatggagttcagtctg
tttggaatcccttatactggagcagacatctgtggattcttcaacccctcagagtatgaa
ctgtgcttgcgctggatgcagctcggtgccttctatccatactcacgcaaccacaacggc
ttgggcaacccgagacaagacccggttgcttgggacgaattcttcgccaacgcctccaga
gatgctctgaacatccgctacaccctgttaccttacctctacacgctgatgtacgaggcc
cacaccaaggggagcaccgtcatccggcccctgctccacgagtttgtcagtgataaaaat
acatgggatatccacacacagttcctatggggaccagcatttctcataacaccagccttg
gacatgggcgtcagagaagtgagaggatatgtccctcgtgaccgctggtacgattatcac
acggctagagacgtgggtgtgcgaggacagacggtcgtcatgccaacaccacttgaccat
attaaccttcatgtcagaggaggttatatcttgccatggcagagaccagagctaaacacg
aagttgagtcgcacaaatccacttggactgatcgtggccctgagtgattccaacaccgca
caaggatccttcttctgggacgacggggagagcatcgacactgcagagagaaacgagtat
ctgttcacatccttctcggtgcaatcgaacaacctgaccaacaacccgattcacactgga
ctgaaccctgctgaccgcctgatgatgggcgtggtgaagatttggggagcaggcagtgtg
caaatcacccaggcaacgctcactgacttttcaggaacaccgagcctactcactgtccag
cacaacctcgacacacaggagctgataatcgatgtcacggctaaaaatcagcgagtggat
cagcccttctctatatcatggagatcatag

DBGET integrated database retrieval system