KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110174870
Entry
110174870         CDS       T05002                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04068  FoxO signaling pathway
bpec04110  Cell cycle
bpec04115  p53 signaling pathway
bpec04218  Cellular senescence
bpec04310  Wnt signaling pathway
bpec04340  Hedgehog signaling pathway
bpec04371  Apelin signaling pathway
bpec04510  Focal adhesion
bpec04530  Tight junction
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110174870
   04340 Hedgehog signaling pathway
    110174870
   04371 Apelin signaling pathway
    110174870
   04068 FoxO signaling pathway
    110174870
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110174870
   04115 p53 signaling pathway
    110174870
   04218 Cellular senescence
    110174870
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110174870
   04530 Tight junction
    110174870
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110174870
NCBI-ProteinID: XP_020796639
LinkDB
Position
Unknown
AA seq 349 aa
MSQEVSVSLWCEEAGDAHSFLEDDHRESRVLAEIPVQTPVQVQEQVQEQVQDQVQEQVQE
QVQERCEVPAAWDPSVVGQRAVTRLLQLERRYLPSALYVRLIQGAPQSRDELVKWAMEVC
SDVGCEEQVFPLSVSLLDRFLSLTLSVPAAPVCLVASCVLVASKLTECETLPVDTLCAAA
EYSFSSHSLREMERVLVATLRWDLASVTPQDFLPHFLSAAVTSWRRGGSDLASTARRHAD
TLSALCVCDSRFLGAPPSLLAAGALCCALKGLRAPQNLENLENLELSTERLAHLCQTDPA
VLQYFSEMIELVLRERLSGGLQSAPSQKDEELTEEPRPGTPTDMTEIDF
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtcccaggaggtgtccgtgtcgctctggtgtgaagaagcaggagacgctcacagtttt
ctggaggacgaccacagggagtcaagagtcctggctgagatcccggtccagaccccggtc
caggtccaggagcaggtccaggagcaggtccaggatcaggtccaggagcaggtccaggag
caggtccaggagcggtgcgaggtcccggccgcctgggacccgtcggtggtggggcagagg
gccgtgacgaggctcctgcagctggagaggagatacctgccctctgcgctttacgtccga
ctcatccagggggcgccacagagcagagacgaactggtcaagtgggccatggaggtgtgc
tcggacgtgggctgtgaggagcaggtgttccccctgtcggtgtccctgttggacaggttc
ttgagtttgaccctgtcggtccctgccgctcccgtctgtctggtggcgtcctgcgtcctc
gtggcgtccaaactgaccgagtgcgagacgcttcccgtggacacgctgtgcgccgccgcc
gagtacagcttcagctcgcacagcctcagggagatggagcgagttctcgtggcgactctt
cgttgggacctggcgtccgtcacgcctcaggacttcctgcctcacttcctgtcggcggcg
gtgacgtcgtggcgtcgcggcggctcggacctggcgtcgacggcgcgcagacacgccgac
acgctctctgctctgtgcgtgtgcgactcgcgcttcctcggggccccgccgtccctgctc
gccgccggagctctgtgctgcgccctcaaaggtctgagggccccgcagaacctggagaac
ctggagaacctggagctgagcacggagagactcgcccacctgtgccagaccgaccccgcc
gtgctgcagtacttctcggagatgatcgagctggttctccgtgagcgtctgagcggtgga
ctccagagcgccccctcgcagaaggacgaggaactgacggaggagccgcgccccgggacg
ccgacggacatgaccgagatcgacttttaa

DBGET integrated database retrieval system