KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110175118Help
Entry
110175118         CDS       T05002                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec03030  DNA replication
bpec03410  Base excision repair
bpec03420  Nucleotide excision repair
bpec03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110175118 (lig1)
   03410 Base excision repair
    110175118 (lig1)
   03420 Nucleotide excision repair
    110175118 (lig1)
   03430 Mismatch repair
    110175118 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bpec03032]
    110175118 (lig1)
   03400 DNA repair and recombination proteins [BR:bpec03400]
    110175118 (lig1)
Enzymes [BR:bpec01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110175118 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     110175118 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110175118 (lig1)
DNA replication proteins [BR:bpec03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110175118 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110175118 (lig1)
DNA repair and recombination proteins [BR:bpec03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110175118 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     110175118 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     110175118 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 110175118
NCBI-ProteinID: XP_020796891
LinkDB All DBs
Position
Unknown
AA seq 1003 aa AA seqDB search
MQRSIASFFQAKTKEKKSGDEPVKKPVKSPLKVHNGAHEADSPVKKPPKRSRQILDSDED
EAPENQTTAVKEREKKEKSGEKKIEKEEEKKAEKDEVLKAPTPKSPPPTPSTPRTPATPA
TPAPVSTPVSTPATAPATPALSASSGTPCTPDSISPSGIVKRKTARKMFPKRKLNESGSE
SREKEDSEEKDGAGHQNKRARVESEASTAGSADEPMEEETKQESTEKAVTAKSTAANELL
QSEKAKEEPIQEASTKTDKIYDDEKPTTVTTATKIEKKMPEKDEESSKSQAENTQGDKEP
AKKPAISSFFAPRKAAAVTVKTEKVERGEEKKTERKSLGEESKSEVTSGQTDYNPSRPNY
HPINDACWKHGQKVPYLAVARTFERIEEDSGRLRNIETLSNFFRSVLLLSPDDLLCCVYL
CLNQLGPAYLGMELGVGETVLMKAVAQTTGRQLDKIKAEAQEKGDLGLVAESSRSNQRMM
FQPASLTATAVFKKLKEIAAMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIG
LAELSVLSALSQAVCLTPPGQDFPPAVIDAGKGMSSDSKRSWIEEKTLILKQTYCEMPNY
DVLIPVLLKEGIEELPKHCKLTPGVPLRPMLAHPTKGVGEVMKKFDEAAFTCEYKYDGER
AQIHILENGDVRIFSRNQEDNTTKYPDIISRIPKVKKESVVSCVLDSEAVAWDREKKQIQ
PFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVKQPLSRRRALLHESFSEVEGEF
VFAKSIDSDNTDTIAEFLEQSVKDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLDGV
GDTVDLCVIGAYLGKGKRTGTYGGFLLACYDEENEEFQSVCKIGTGFKDEDLEQHYKFLK
EHILPKPRAYFRFDPSAEPDVWLDAVQVWEVKCADLSLSPVYKAGLGLVDPEKGISLRFP
RFLRIRDDKKPEDATTGSQIADLYRKQQQIQNQGEKADPEDYY
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagtattgcgtccttttttcaggccaaaactaaagaaaagaaatctggagat
gaacctgtgaaaaagccggtgaagagtcccctgaaggtgcacaacggggctcatgaggca
gattctccggtgaaaaaacctcccaaacggagccgtcagattctggacagtgacgaagac
gaggccccggaaaaccagaccactgctgtcaaagagagagagaagaaggagaagagcgga
gagaagaagatagagaaagaggaggagaagaaggctgagaaggatgaagttttgaaagcc
ccaacccccaagtctcctcctccgacccccagcacccccaggacacctgccacccctgcc
acacctgcacctgtctctacaccagtctctacacctgccactgcacctgctaccccggcc
ctgtccgcctcctctgggactccctgcaccccagactccatctctccatccgggattgtc
aaacgcaaaactgcgaggaagatgttccccaagaggaagctgaacgagagcgggagcgag
agccgagaaaaagaggattccgaggagaaggacggagcaggtcatcaaaacaaacgcgcc
cgagtggagagcgaagctagcacagcaggtagcgctgatgagccaatggaagaggagacc
aagcaggagagcactgaaaaggctgttaccgccaaatccactgctgcaaatgagctgctc
cagtctgaaaaggccaaagaggaacccatccaagaagcatctacaaaaacagacaagatt
tatgatgatgagaaaccaaccactgtcaccacggcgacaaaaattgagaaaaaaatgcct
gaaaaggacgaagaaagctccaaaagtcaagccgagaatacacaaggagataaggagccc
gccaagaaaccggcaatcagcagtttctttgctccaagaaaagcagcagcagtgacggtg
aaaactgagaaagtagagcgaggtgaagaaaagaagacagagagaaagagtttgggagag
gagagtaaaagtgaggtaacatcaggacagaccgactacaatccttccagaccaaactat
caccccatcaacgacgcctgctggaagcacggacaaaaggtgccgtatctggctgtggcg
cgcacctttgagagaattgaagaggattccggcaggctcagaaacatcgagactctgtcc
aatttcttccgctcggtgctgctgctgtctccagatgacctgctgtgctgtgtgtacctg
tgcttaaaccagctgggccccgcctacctggggatggagctgggagtgggagagaccgtg
ctcatgaaggccgtggcccagacaacaggtcgtcagttggataaaatcaaagcggaggct
caggagaagggggacctaggactggttgctgagagctctcggagtaatcaaaggatgatg
ttccagccggcgagcctgaccgccaccgctgtgttcaagaaactgaaggagatcgcagcc
atgagtggaaactcggccatgaataagaaaatcgacatcatcaaagggcttttcgtggcc
tgtcgtttttctgaagcgcgctacatcgtcaggtcgctggctgggaaactaagaataggc
ctggcggagctgagcgtcctgtctgcattaagccaagctgtgtgtctgaccccacctgga
caagatttcccccctgctgtgatcgacgctggcaaaggcatgagctcagacagcaaacgc
tcctggatcgaagaaaaaactctcatcctcaaacagacctactgtgaaatgcccaattac
gacgtgctgattccggttctgctgaaagagggcatcgaagagctccccaaacactgcaaa
ctcactccaggagtccctctcaggcccatgttggctcatccgaccaaaggagtgggagag
gtcatgaagaagtttgacgaggccgccttcacctgcgagtacaagtacgacggagagagg
gctcagattcacatcctggagaacggagacgtgcgcattttcagccgtaaccaagaagac
aacacgaccaagtacccagacatcatctctcgcatcccaaaggtgaagaaggagtctgtg
gtatcatgtgtgctggattccgaggctgtggcttgggacagagagaagaagcagatccag
ccatttcaggtgctcaccacaagaaagagaaaggatgtggatgcctctgaaatcaaagtc
caagtttgtgtttacgcatttgacctgctctacctgaacggagagtctttggtgaagcag
ccgctgtctcggcgacgggctctgctccatgagagtttttctgaagtggaaggagagttt
gttttcgccaagtccatcgactcggacaatactgacaccatcgcggagttcctggagcag
tctgtgaaagattcctgtgaaggtctgatggtgaagactctggagaaggatgcaacttat
gaaattgccaaaagatctcataactggctcaagttgaagaaggactacctggacggcgtt
ggagacactgtggacctgtgtgtgattggagcatatctggggaaagggaaaaggaccggg
acctacggcggcttcctattggcctgttacgacgaggagaacgaggagtttcagtctgtc
tgcaagatcgggacggggttcaaagacgaagacctggagcagcactacaagtttctgaag
gagcacatcttgccaaagccccgagcgtacttcaggtttgacccgtcggcggagcctgac
gtgtggctggacgcggtgcaggtctgggaggtcaaatgtgccgacctctcgctctctcca
gtttacaaggctggactcggactggtggatccagaaaagggaatttctttaagatttcct
cgtttccttcgaatcagagacgacaagaaacccgaggacgctaccaccgggtctcagatt
gcagatttgtacaggaagcagcagcagatccagaatcagggagagaaggcggacccggag
gattactactga

DBGET integrated database retrieval system