KEGG   Bordetella pertussis 18323: BN118_0087Help
Entry
BN118_0087        CDS       T02296                                 

Definition
(GenBank) putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00790  Folate biosynthesis
bper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN118_0087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bper04147]
    BN118_0087
Enzymes [BR:bper01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BN118_0087
Exosome [BR:bper04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN118_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a Sun2_CC2
Motif
Other DBs
NCBI-ProteinID: CCJ61512
UniProt: A0A0T7CJ84
LinkDB All DBs
Position
100122..100499
Genome map
AA seq 125 aa AA seqDB search
MPAGGRGRGEFAMSTEFPMRIGAEVALPALQGWNAAAGRDAIEKRYRFDNFNAAFGFMAR
VAMFAEKMDHHPEWRNVYNRVDVTLTTHDAGGVTELDVRMAQFMDEAAGRLGATGLPARA
DQPRT
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgccggctggcggacgcggccgcggggagtttgcgatgagtacggaatttccgatgcgt
atcggcgccgaggtggcgctgccggccttgcagggctggaacgcggcggccgggcgcgac
gccatcgagaagcgctatcggttcgacaatttcaatgccgcgttcggcttcatggcgcgc
gtggcgatgttcgccgagaaaatggaccaccacccggaatggcgcaatgtctacaaccgg
gtcgacgtgacgctgaccacccatgacgccggcggggtgaccgagctggatgtgcgcatg
gcgcagttcatggacgaggcggccgggcgcctgggcgccaccggcctgccggcgcgcgcg
gatcagccgcgcacgtag

DBGET integrated database retrieval system