KEGG   Bordetella pertussis 18323: BN118_0174Help
Entry
BN118_0174        CDS       T02296                                 

Definition
(GenBank) putative penicillin-binding protein precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00550  Peptidoglycan biosynthesis
bper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN118_0174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bper01002]
    BN118_0174
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bper01011]
    BN118_0174
Enzymes [BR:bper01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN118_0174
Peptidases [BR:bper01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BN118_0174
Peptidoglycan biosynthesis and degradation proteins [BR:bper01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BN118_0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CCJ61599
UniProt: A0A0U1RMR6
LinkDB All DBs
Position
186271..187527
Genome map
AA seq 418 aa AA seqDB search
MKTLPDTAIAPVVLSRRVLASAVLAAMLAAAAPAGAQQQAAPATPVAAAAPAAGGAVGAV
GDLAAVPVPTIAAKAWITVDVNSGQVLAASNADMKVEPASLTKIMTAYVVFNALQEKRLT
LEQQVPVSEHAWRTGGSRMFIEPRKPVTVDELNQGMIVQSGNDASVALAEAVGGSESAFA
ALMNQEAQRLGMRNTHFMNSTGLPDPQHVTTARDLATLAAHLISDYPDYYHYYKQKSYTY
NKITQANRNRLLWADPSVDGMKTGHTDSAGYCLVSTAMRGDRRILTVLVGADSEATRAEE
SLKLLNWSFQNFDTVKLYDQSQPGLDARVWEGKVENVKLGPPNPVWLAVPRGKAAEIKPV
AQRTDPLVAPLTKGQQVGTLQLTLDGKTLRVEPLVVQEDVERAGFFGRMADTVKRWFQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttgcctgatactgctattgcccccgtcgttctttcccgtcgcgtattggcc
agcgccgtgctggctgccatgctggccgctgcggcgccggccggggcccagcagcaggcg
gcgcccgccacgcctgtcgccgccgccgcgcccgcggcgggcggcgcggtaggcgccgtg
ggagacctggcggccgtgccggtgccgaccatcgccgccaaggcgtggatcaccgtggac
gtcaacagcggccaggtgctggcagcctccaacgccgacatgaaggtcgagccggcctcg
ctgaccaagatcatgaccgcctatgtggtgttcaacgcgctgcaggaaaagcgcctgacc
ctggagcagcaggttccggtctccgagcacgcatggcgcaccggcggttcgcgcatgttc
atcgagccgcgcaagccggtgacggtcgacgaactgaaccagggcatgatcgtccagtcg
ggcaatgacgcatcggtcgcgctggccgaggccgtcggcggcagcgaaagcgcctttgcg
gccctgatgaaccaggaggcgcagcgcctgggcatgcgcaatacgcatttcatgaactcc
accggcctgcccgatccgcagcacgtcaccacggcgcgcgacctggccacgctggcggcg
cacctgatctcggattacccggactactaccactactacaagcagaaaagctacacgtac
aacaagatcacccaggccaaccgcaaccgcctgttgtgggccgatccgtcggtcgacggc
atgaagacggggcacaccgattcggccggctactgcctggtttcgaccgccatgcgcggc
gaccgccgtatcctgaccgtgctggtgggcgccgacagcgaagccacgcgcgccgaggaa
agcctcaagctgctcaactggagcttccagaacttcgatacggtcaagctgtacgaccag
agccagcccgggctggacgcgcgggtctgggaaggcaaggtcgagaacgtcaagctgggt
ccgcccaacccggtgtggctggcggtgccgcgcggcaaggcggccgagatcaagccggtc
gcgcagcgcaccgacccgctggtggcgccgctgaccaagggacagcaggtcggcacgctg
cagctcacgctcgacggcaagaccttgcgcgtcgaaccgctggtggtccaggaagacgtc
gagcgcgccggcttcttcggccgcatggccgacaccgtgaagcgctggttccagtaa

DBGET integrated database retrieval system