KEGG   Bordetella pertussis 18323: BN118_0217Help
Entry
BN118_0217        CDS       T02296                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00061  Fatty acid biosynthesis
bper00780  Biotin metabolism
bper01100  Metabolic pathways
bper01130  Biosynthesis of antibiotics
bper01212  Fatty acid metabolism
Module
bper_M00083  Fatty acid biosynthesis, elongation
bper_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN118_0217 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BN118_0217 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BN118_0217 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bper01004]
    BN118_0217 (fabI)
Enzymes [BR:bper01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BN118_0217 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BN118_0217 (fabI)
Lipid biosynthesis proteins [BR:bper01004]
 Fatty acid synthase
  Component type
   BN118_0217 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CCJ61642
UniProt: A0A0T7CJF6
LinkDB All DBs
Position
227255..228040
Genome map
AA seq 261 aa AA seqDB search
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIV
LPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDIS
AYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGP
RGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAG
ITGEITHVDAGFSTVVPGMEN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgccggcaagcgcatcctcatgaccggggtgctttccaaccgatccatc
gcctacggcatcgcgcgcgcctgccgcgaccagggcgccgacctggcgttcacctacgtg
ggcgaccgcttcaaggaacgcatcaccgaattcgccgcctcgttcggcagcgacatcgtg
ctgccctgcgacgtggccgaggacagccagatcgacgccgccttcgccgaactgggcaag
cgctgggacggcctggacggcctggtgcacgccatcggcttcgcgccgcgcgaagcgatc
gccggcgacttcctcgacggcctgtcgcgcgagaactttcgtatcgcgcacgatatctcg
gcctacagcttcccagccatggccaaggcggcgctgccgctgatggaaggccgcaagggc
tcggtcctgaccctgagctacctgggctccgagcgcgtggtcgccaactacaacaccatg
ggcctggccaaggcctcgctggaagccagcgtgcgctacctggccaccgccctcggcccg
cgcggcatccgcgccaacgccatctcggccggccccatcaagacgctggccgccagcggc
atcaaggacttctcgtcgatcctgaagttcgtcgaagccaacgccccgctgcgccgcaac
gtcaccatcgaagacgtcggcaacgtcgccgccttcatgctgtccgacctcgccgccggc
atcaccggcgaaatcacccacgtcgacgccggcttctcgaccgtcgtcccgggaatggaa
aactga

DBGET integrated database retrieval system