KEGG   Bordetella pertussis 18323: BN118_2456Help
Entry
BN118_2456        CDS       T02296                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00564  Glycerophospholipid metabolism
bper01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN118_2456
Enzymes [BR:bper01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN118_2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 Thi4 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CCJ63881
UniProt: A0A0T7CQQ5
LinkDB All DBs
Position
2682250..2683866
Genome map
AA seq 538 aa AA seqDB search
MTAPTLAPIDPPARAQLLTDLQGAPDWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADF
AKGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYSLLDQ
PFYGVGLKMYDMLAGKLNLAPSRWLSRGETLRHAATVAERVNGRALRGGILYYDGQFDDA
RLAIALMRTLYDLGGVALNYARAVGLTRTDGRVDGVTVADALGELRVTLRVTLRAKCVVN
ATGVWVDAVRRMDDPAAQTMVAPSQGVHLTLPRDFLPGEDAILIPKTDDGRVLFVVPWNG
HTIVGTTDTPRTDLPLDPQAGQNEIDFILATAARYLSRKPTRADVTSVWAGLRPLVKATG
EASTKSLSREHTIVVSKGGLVTVTGGKWTTYRKMAQDVVDTAIEHKLLAAAPCRTSELPL
HGAPADGQPNGAPHGTPDSYYGTDLATLRALPGADRMLVKASALTEAHVRYAARHELART
VEDVLARRNRALFLDAEAALLAAPEVARILAQELGHDEAWSRATLAEFEAVAAHYRLA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctaccctcgctcccatcgacccgcccgcgcgcgcgcaactgcttaccgac
ctgcaaggcgcccccgattgggatgtcatcgtcatcggcggcggcgccaccggcctgggc
accgccgtcgatgccgccgcgcgcggctaccgcaccctgctggtcgaggccgccgacttc
gccaagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcg
cagggcaatatcagcctggtgcgcgaggccctgcacgaacgcggcctgctcaaccgcaac
gcgccgcacctggtgtggccgctgggcttcgtcgtgccggcctacagcctgctggaccag
ccgttctacggcgtcggcctgaagatgtacgacatgctggccggcaagctgaacctggcg
cccagccgctggctgtcgcgcggcgaaacgctgcgccacgccgccaccgtggccgagcgc
gtcaacggacgagccttgcgcggcggcatcctgtactacgacggccagttcgacgacgcg
cgcctggccatcgccctgatgcgcaccctgtacgacctgggcggcgtggcgctgaactat
gcgcgcgcggtcggcctgacgcgcacggacggccgcgtcgacggcgtgacggtggccgac
gcgctgggcgagctgcgcgtgacgctgcgcgtgacgctgcgcgccaaatgcgtggtcaac
gccaccggcgtgtgggtcgacgcggtgcgccgcatggacgaccccgccgcgcagaccatg
gtggcgcccagccagggcgtgcacctgacgctgccgcgcgacttcctgcccggcgaagac
gccattctcatacccaagaccgacgacggccgggtgctgttcgtggtgccctggaacggc
cacaccatcgtcggcaccaccgacacgccgcgcaccgacctgccgctcgatccgcaggcc
ggccagaacgaaatcgacttcatccttgccaccgcggcgcgctacctgagccgcaagccc
acccgcgccgacgtgaccagcgtgtgggccggcctgcgcccgctggtcaaggccaccggc
gaagcctcgaccaagtcgctgtcgcgcgaacacaccatcgtggtctccaagggcgggctg
gtcacggtcaccggcggcaaatggaccacctaccgcaagatggcccaggatgtggtcgac
accgccatcgagcacaagctgctggccgcggcgccatgccgcacgtccgagctgccgctg
catggcgcgccggccgacgggcagcccaacggcgcgccccacggcacgcccgacagctac
tacggcaccgacctggcgacgctgcgcgcgctgcccggcgccgaccgcatgctggtcaag
gccagcgccctgaccgaggcgcacgtgcgctatgccgcccgccacgaactcgcgcgcacc
gtggaggacgtgctggcccgccgcaatcgcgccctgttcctggacgccgaggccgccctg
ctggccgcgcccgaagtggcccgcatcctggcgcaggaactcggccacgacgaagcctgg
agccgcgccacgctggccgagttcgaggccgtggccgcgcactaccggctggcctga

DBGET integrated database retrieval system