KEGG   Bordetella pertussis 18323: BN118_2969Help
Entry
BN118_2969        CDS       T02296                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bper01100  Metabolic pathways
bper01110  Biosynthesis of secondary metabolites
bper01130  Biosynthesis of antibiotics
bper01230  Biosynthesis of amino acids
Module
bper_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN118_2969 (aroK)
Enzymes [BR:bper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BN118_2969 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 TsaE AAA_16 AAA AAA_25 APS_kinase AAA_5 Zeta_toxin Ploopntkinase3 Cytidylate_kin2 ATP_bind_2 AAA_7
Motif
Other DBs
NCBI-ProteinID: CCJ64394
UniProt: A0A0T7CS50
LinkDB All DBs
Position
complement(3255956..3256591)
Genome map
AA seq 211 aa AA seqDB search
MNASANLCAASANDPQPGDQEAAHPVACAGDEPAAFLPHDLPIFLVGMMGAGKTTIGRGL
ARALRREFIDLDHELEARCGVRVPVIFEIEGEAGFRRREAAALQECTQRRQIILATGGGA
VLAAENRQALRERGIVIYLRASVEELFRRTSRDRNRPLLATADPRATLRELMVAREPLYN
EVADLVIDTGSMPIATLVKSLLPKLQAYEKK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttccgctaatttatgcgcggcgtccgccaacgacccgcaaccgggcgaccag
gaggccgcccaccctgtagcctgcgccggtgacgagccggcggcgttcctgccgcacgac
ctgccgatctttctggtggggatgatgggcgccggcaagaccaccatagggcgaggcctg
gcgcgtgcgctgaggcgcgaattcatcgatctcgaccatgagttggaggcgcgttgcggc
gtgcgggttccggtcatcttcgaaatcgaaggcgaagccgggtttcgccggcgggaagct
gccgcattgcaagagtgtacccaacgccggcagataattcttgccaccggcgggggcgcg
gtgctggccgcggagaaccggcaggccctgcgcgagcgcggcatcgtgatctacctgcgc
gccagcgtggaagagctgttccggcgtaccagccgcgatcgcaaccgccccttgctggcc
accgccgatccgcgcgctaccctgcgcgagctgatggtggcgcgcgaaccgctgtataac
gaggtggccgatctggtcatcgataccggcagcatgcccatcgccacgctggtgaagtcc
ctgctgcccaagctgcaagcctacgagaagaaataa

DBGET integrated database retrieval system