KEGG   Bordetella pertussis 18323: BN118_2970Help
Entry
BN118_2970        CDS       T02296                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00550  Peptidoglycan biosynthesis
bper01100  Metabolic pathways
bper01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN118_2970
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN118_2970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bper01003]
    BN118_2970
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bper01011]
    BN118_2970
Enzymes [BR:bper01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BN118_2970
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN118_2970
Glycosyltransferases [BR:bper01003]
 Polysaccharide
  Bacterial polysaccharide
   BN118_2970
Peptidoglycan biosynthesis and degradation proteins [BR:bper01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BN118_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: CCJ64395
UniProt: A0A0T7CS99
LinkDB All DBs
Position
3256705..3259149
Genome map
AA seq 814 aa AA seqDB search
MSKRQNSTKQDKPAKSGSAILRFFLKAGIFFGGLALCGVLLAGMALALAWPNLPDLHAMT
DYRPRVPLRVYTADRVLIGEFGEERRNVLRFNEIPDVMKSAVLAAEDDRFYQHGGIDWMG
VIRAGLTNLISMSKSQGASTITMQVARNFYLSSEKTYSRKFYELLLTFKIESQLTKDQIL
ELYMNQIYLGHRAYGFAAASRTYFGKPLSQVTPSEAAMLAGIPKAPSRFNPISNRPRAEL
RQRYVLGRMYSLGYLTEPEYKEAMAQPIVIKSAEGTPAGGYAIHGEYVAELARQLLYNVY
QDNLYSRGINIYTTVQSKDQESAYRAVRDGVLEYTRRAPYPGPEEQLDMPAGVENDPQAL
DEFLDGVFDKFSDSGDLLTAVVLSASPTEIKLVRSSREVISITDKKALGVVARALTDKAK
PEMRLKRGSVVYIHKYNDNWEVINMPAVQAAFVALSPQDGAIRAMVGGFDFYRGNFNRVT
QAWRQPGSNIKPFIYAASLERGLTPATQISDQPFELSAAQTGSKAWHPKNYGNQYEPMLT
MRQGLYKSKNMVSIRILQAIGPQYAQDYLTRFGFDKARQPAVLPLALGAGSVTPLQLAGA
YAVFANGGYRITPYLIDRVTDSSGKVLMQSRPVIAGDAAARAIDARTAFVMDDMLRGVAT
SGTAARARATLKRSDVAGKTGTTNESVDAWFSGYTPSLVATAWLGFDQPKSLGSRETGGG
VAMPIWLDYMKDALKGVPEEKQRPRPDGLLVENGELYFSEFPPGQAVARLGLPQAGDALG
DFLNGLTGGNDNSIRVAPGVGTQGSQPWSQNIPF
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgccagaattcaaccaagcaggacaagcccgccaagagcggttcagcgatt
ttgcggttcttcctgaaggccggcatcttctttggcggcctggccctgtgcggcgtactg
ctggccggcatggccctggcgctggcctggcccaacctgcccgatctgcacgccatgacc
gactatcggccgcgcgtgccgctgcgcgtctatacggccgaccgggtgctgatcggcgaa
ttcggcgaagagcgccgcaacgtgctgcgcttcaacgaaatccccgatgtcatgaagtcg
gcggtgctggccgccgaggacgatcgtttctaccagcacggcgggatcgactggatgggc
gtcatccgcgccggcctgaccaacctgatcagcatgtcgaagtcgcaaggcgcgagcacc
atcaccatgcaggtggcgcgcaacttctacctgtcgtccgagaagacctattcgcgcaag
ttctacgaactgctgctcaccttcaagatcgaatcgcagctcaccaaggaccagatcctc
gagctgtacatgaaccagatctacctgggccatcgcgcctacggcttcgccgccgcctcg
cgcacctatttcggcaagccgctgtcgcaggtcacgccgtccgaggccgccatgctggcc
ggcattcccaaggcgccgtcgcgcttcaacccgatttccaaccgcccgcgcgccgaactg
cgccagcgctatgtgctgggccgcatgtattcgctgggctacctgaccgagcccgaatac
aaggaagcgatggcgcagcccatcgtgatcaagtcggccgaaggcacgccggccggcggc
tacgccatccatggcgaatacgtcgccgaactggcgcgccagctgctctacaacgtgtac
caggacaacctgtattcgcgcggcatcaacatctacaccaccgtccagtcgaaggaccag
gaatcggcctatcgcgcggtgcgcgacggcgtgctcgaatacacgcggcgcgcgccctac
cccggccccgaggaacagctggacatgccggccggcgtcgagaacgacccgcaggcgctg
gacgaattcctcgatggcgtgttcgacaagttctccgacagcggcgacctgctgaccgcc
gtcgtgctgtcggccagccccaccgagatcaagctggtgcgcagctcgcgcgaagtcatc
tccatcaccgacaagaaggcgctgggcgtggtggcgcgggcgctgacggacaaggccaag
cccgagatgcgcctgaagcgcggctcggtcgtctacatccacaaatacaacgacaactgg
gaagtcatcaacatgccggcggtgcaggccgcgttcgtggcgctgtcgccgcaggacggc
gccatccgcgccatggtcggcggcttcgacttctaccgcggcaacttcaaccgcgtgacg
caggcatggcgccagcccggctcgaacatcaagccgttcatctatgccgcctcgctcgag
cgcggcctgacgccggccacccagatctccgaccagccgttcgaactgtccgcggcgcag
accggctccaaggcctggcatccgaagaactacggcaaccagtacgagcccatgctgacc
atgcgccagggcctgtacaagtcgaagaacatggtgtccatccgcatcctgcaggccatc
gggccgcagtacgcccaggactacctcacccgcttcggtttcgacaaggcgcgccagccc
gccgtgctgccgctggcgctgggcgccggctcggtcacgcccttgcagctggccggcgcc
tatgcggtgttcgccaacggcggctaccgcatcacgccctacctgatcgatcgcgtcacc
gacagctccggcaaggtcctgatgcaatcgcgtccggtcatcgccggcgatgcggccgcg
cgcgccatcgacgcgcgcaccgccttcgtcatggacgatatgctgcgtggcgtggccacc
agcggcaccgccgcccgcgcccgcgccacgctcaagcgcagcgacgtcgccggcaagacc
ggcaccaccaacgaatcggtcgacgcctggttctcgggctatacgcccagcctggtggcc
accgcatggctgggcttcgaccagcccaaatcgctgggctcgcgcgagaccggcggcggc
gtggccatgccgatctggctcgactacatgaaggatgcgctcaagggcgtgcccgaagag
aagcagcggccgcgtcccgatggcctgctggtggagaacggcgagctctatttcagcgag
ttcccgcccggccaggcggtggcgcgcctgggcttgccccaggccggcgacgcgctgggc
gacttcctgaacgggctgaccggcggcaacgacaattcgatccgcgtggcgcccggcgtg
ggcacgcaagggtcgcagccctggagccagaacatcccgttctga

DBGET integrated database retrieval system