KEGG   Bordetella pertussis 18323: BN118_3572Help
Entry
BN118_3572        CDS       T02296                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00340  Histidine metabolism
bper01100  Metabolic pathways
bper01110  Biosynthesis of secondary metabolites
bper01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BN118_3572 (hisE)
Enzymes [BR:bper01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BN118_3572 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: CCJ64997
UniProt: A0A0T7CTV1
LinkDB All DBs
Position
3866447..3866794
Genome map
AA seq 115 aa AA seqDB search
MTTPTAGDDILSRIADTLATRRPEAGGDPQSSYVAKLLSKAPDAFLKKIGEEATELVMAA
KDGQPDRIISETADLWFHCLVALTHYNLRPEDVLAELARREGLSGLEEKARRPRD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgaccgccggcgacgacatcctgtcgcgtatcgccgataccctggccacg
cgccgccccgaggccggcggcgatccgcagtcgtcctacgtcgcgaagctgctgtccaag
gcgcccgacgccttcctgaagaagatcggcgaagaagctaccgagctggtcatggcggcc
aaggacggccagcccgaccgcatcattagtgaaaccgctgatctctggttccactgtctg
gtagccttgacccattacaatctgcgacccgaggacgtactggccgagctggcgcgccgc
gagggattgtccggcctcgaggaaaaggcccggcggccgcgagactga

DBGET integrated database retrieval system