KEGG   Bordetella pertussis B1917: B1917_2845Help
Entry
B1917_2845        CDS       T03638                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet00061  Fatty acid biosynthesis
bpet00780  Biotin metabolism
bpet01100  Metabolic pathways
bpet01130  Biosynthesis of antibiotics
bpet01212  Fatty acid metabolism
Module
bpet_M00083  Fatty acid biosynthesis, elongation
bpet_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bpet00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B1917_2845 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B1917_2845 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    B1917_2845 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bpet01004]
    B1917_2845 (fabI)
Enzymes [BR:bpet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     B1917_2845 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     B1917_2845 (fabI)
Lipid biosynthesis proteins [BR:bpet01004]
 Fatty acid synthase
  Component type
   B1917_2845 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AIW93114
LinkDB All DBs
Position
3022948..3023721
Genome map
AA seq 257 aa AA seqDB search
MNAAAPLQGRRGLVTGIANQDSIAWGCARAFRALGAELAVTYLNDKARVHVEPLARSIDA
ALLLPLDLRVDGQLESVFEQIGARWGSLDFVMHSIAYAPRDDLRGRVVDCSRAGFLQAMD
ISCWSFIRMAHLAEPLMPKGGTLFCMTYYGSQMVVEHYNMMGPVKAALESATRYLAAELG
PQGIRVHAISPGPLKTRAASGITGFDALLDRAQAKAPARSLVGIDDVDEATAWLATDAAR
RITGQTLYIDGGYHIID
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgccgcccccctgcagggccggcgcgggctcgtcaccggcatcgccaaccag
gactcgatagcctggggttgcgcgcgcgccttccgcgcgctgggcgccgaactggccgtg
acctacctgaacgacaaggcgcgcgtccacgtcgagccgctggcgcgcagcatcgacgcc
gccctgctgctgccgctggacctgcgcgtcgacggccagctcgaatccgtgttcgagcaa
atcggcgcgcgctggggcagcctggatttcgtcatgcattcgatcgcctacgcgccgcgc
gacgatctgcggggacgcgtggtcgactgctcgcgcgcaggcttcctgcaggccatggac
atctcgtgctggtcgttcatccgcatggcgcacctggccgagcccctgatgcccaagggc
ggcaccctgttctgcatgacctactacggctcgcagatggtggtggagcactacaacatg
atggggccggtgaaggcggcgctggaatcggccacccgctacctggcggccgaactgggt
ccgcagggcatacgcgtgcacgccatctcgcccgggccgctcaagacccgcgccgcctcg
ggcatcaccggcttcgacgccttgctggaccgcgcccaggccaaggcgccggcgcgcagc
ctggtcggcatcgacgacgtggacgaggccaccgcctggctggccaccgacgcggcgcgc
cgcatcaccggccagaccctctacatcgacggcggctaccacatcatcgattga

DBGET integrated database retrieval system