KEGG   Bordetella pertussis 137: Q425_11960
Entry
Q425_11960        CDS       T03754                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K17321  glycerol transport system substrate-binding protein
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Q425_11960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpeu02000]
    Q425_11960
Transporters [BR:bpeu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glycerol transporter
    Q425_11960
SSDB
Motif
Pfam: SBP_bac_8 DUF3862 DUF4863
Other DBs
NCBI-ProteinID: AJB25945
LinkDB
Position
1240727..1242457
AA seq 576 aa
MKMRMHAMAAAIALIGTQAAWAGEPEAKKWVDSEFQPSSLSKDQQMAEMKWFIDAAEKLK
AKGVSEINVVSETITTHEYEAKTLARAFTEITGIKVNHDLIQEGDVVEKLQTSMQSGKSI
YDGWISDSDLIGTHYRYGAILPLSDYISGAGKEYTNPGLDLKDFIGTKFTTAPDGKLYQL
PDQQFANVYWFRVDWFARKDLQDKLKAKYGYELGVPTNWSAYEDIAEFFSNDVKELDGKR
VYGHMDYGKKDPSLGWRFTDAWLSMAGAADKGLPNGMPVDEWGIRVADDKCTPVGASVAR
GGATNSPAAVYALTKYVDWMKKYAPQQATGMTFSESGPVPAQGQIAQQIFWYTAFTADMT
KKGLPVVNEDGTPKWRMAPSPYGPYWKDGMQNGYQDVGSWTFFKSTDANRLAGAWLYAQF
VTSKTVSLKKSITGLTFIRDSDINSEFFTKNAANYGGLVEFYRSPARVAWTPTGNNVPDY
PKLAQLWWKNVATAVTGEKTPQQAMDTLANEMDQVLARLERAGMAQCAPKLNPKSDPAKW
LSDQHAPWKKLANEKPQGQTIAYEKLLQAWREGKVR
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaaaatgcgcatgcatgccatggcggccgccatcgccctgatcgggacgcaggcggcc
tgggctggcgagccggaggcgaagaaatgggtggacagcgagttccagccctcgtcgctg
tccaaggaccagcagatggcggaaatgaagtggttcatcgacgcggccgagaagctgaag
gccaagggagtgagcgagatcaacgtggtgtccgagaccatcacgacgcacgagtacgaa
gccaagacgctggcgcgcgccttcaccgagatcaccggcatcaaggtcaaccacgacctg
atccaggaaggcgacgtggtcgagaagctgcagacgtccatgcagtcgggcaagtccatc
tacgacggctggatctccgattcggacctgatcggcacgcactaccggtatggcgccatc
ctgccgctgtcggactacatatcgggcgcgggcaaggagtacaccaatccggggctggac
ctgaaggacttcatcggcaccaagttcaccacggcgcccgacggcaagctgtaccagttg
cccgaccagcagttcgccaacgtctattggttccgggtcgactggttcgcgcgcaaggac
ctgcaggacaagctcaaggccaagtacggctacgaactcggcgtgccgaccaactggtcg
gcctacgaggacatcgccgagttcttctccaacgacgtcaaggagctcgatggcaagcgg
gtctatggccacatggactacggcaagaaggatccctcgctggggtggcgcttcaccgac
gcctggctgtcgatggccggcgcggccgacaagggtctgcccaacggcatgccggtcgac
gaatggggcatccgcgtggccgacgacaagtgcacgccggtgggcgcctcggtggcgcgc
ggcggggccaccaacagcccggccgcggtctatgcgctgaccaagtacgtggactggatg
aagaagtacgcgccgcagcaggccaccggcatgaccttctccgaatccggcccggtgccg
gcgcaggggcagattgcccagcagatcttctggtacaccgcctttaccgccgacatgacc
aagaaggggctgccggtggtcaacgaagacggtacgccgaagtggcgcatggcgccgtcg
ccctatggaccgtactggaaggacggcatgcagaacggttaccaggacgtcggctcgtgg
acattcttcaagtccaccgacgccaaccgcctggccggcgcgtggctctacgcgcagttc
gtgacgtccaagacggtgtcgctgaagaagtccatcaccggcctgaccttcatccgcgac
agcgacatcaacagcgagttcttcaccaagaacgcggccaactacggcggcctggtcgag
ttctaccgcagcccggcgcgcgtggcgtggacgcccaccggcaacaacgtgcccgactat
cccaagctggcgcagctgtggtggaagaacgtggccaccgcggtcacgggcgagaagacg
ccgcagcaggccatggacacgctggccaacgaaatggatcaggtgctggcgcggctggag
cgcgccggcatggcgcagtgcgcgcccaagctgaaccccaagagcgatccggccaagtgg
ctgtcggaccagcacgcgccatggaagaagctggccaacgaaaagccccagggccagacc
atcgcgtatgaaaagctgctgcaggcctggagggagggcaaggtgcgctga

DBGET integrated database retrieval system