KEGG   Bordetella pertussis 137: Q425_34650Help
Entry
Q425_34650        CDS       T03754                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00970  Aminoacyl-tRNA biosynthesis
bpeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Q425_34650 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpeu03029]
    Q425_34650 (gatB)
Enzymes [BR:bpeu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Q425_34650 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Q425_34650 (gatB)
Mitochondrial biogenesis [BR:bpeu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Q425_34650 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AJB27936
LinkDB All DBs
Position
3662119..3663573
Genome map
AA seq 484 aa AA seqDB search
MNWEIVIGLETHTQLSTDSKIFSGSSTRFGAAPNTQANAVDLALPGSLPVMNRGAAERAI
LFGLAVGGKVAPRSVFARKNYFYPDLPKGYQISQYELPVVEGGTLSFFVGEEEKTVNLTR
AHLEEDAGKSLHDEFSLASGAPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYARALHSL
VVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAILFEARRQIE
LIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPPLVIGQDWIDAVRAGMP
ELPAAQRARFEADYGLPAYDAAQLTVSRAMADYFEAVARALPAGQAKLAANWIMGEVAAT
LNREEKDIDAAPVSAAALAALINRIIDGTISNKIARDVFAAMWAGENGGDADAIIEARGL
KQISDSGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAAKGKANPQQVNELLK
EKLG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaaatcgtcatcggcctggaaacgcacacccagctttccaccgactccaag
atcttttcgggtagcagcacgcgctttggcgccgcccccaacacgcaggccaacgcggtc
gacctggcgctgcccggcagcctgccggtcatgaaccgcggcgccgccgaacgcgccatc
ctgttcggcctggccgtgggcggcaaggtcgcgccgcgctcggtgttcgcccgcaagaac
tacttctaccccgacctgcccaagggctaccagatcagccagtacgagctgccggtggtc
gaaggcggcacgctctcgttcttcgtcggcgaggaagaaaaaaccgtcaacctgacgcgc
gcccacctggaagaagacgccggcaagtcgctgcacgacgaattcagcctggccagcggc
gcgccggccagcgggatcgacctcaaccgtgccggcacccccttgctggaaatcgtcacc
gagcccgaaatgcgctcggccgccgaggccgtggcctatgcgcgcgccctgcacagcctg
gtggtctggctgggcatctgcgacggcaacatgcaggaaggctcgttccgctgcgacgcc
aacgtctcggtacgcccggtgggccagaaggaattcggcacccgcaccgaaatcaagaac
gtcaactcgttccgcttcctggaacgcgccatcctgttcgaggcgcgccgccagatcgaa
ctgatcgaggatggcggcaccgtggtgcaggaaacccgcctgtacgacgccgaccgcgac
gaaacccgcagcatgcgcagcaaggaagacgcgcacgactaccgctacttcccggacccc
gacctgccgccgctggtcatcggccaggactggatcgacgcggtgcgcgccggcatgccc
gaactgccggccgcccagcgcgcccgcttcgaggccgactatggcctgcccgcctacgat
gccgcgcaactgaccgtcagccgcgccatggccgactacttcgaggcggtggcgcgcgcc
ctgccggccggccaggccaaactggccgccaactggatcatgggcgaagtcgcggccacc
ctgaaccgcgaagagaaggacatcgacgccgcgcccgtatcggcagccgccctggcggcc
ctgatcaaccgcatcatcgacggcacgatttccaacaagatcgcccgcgacgtgttcgcc
gccatgtgggcgggcgaaaacggcggcgacgcggacgccatcatcgaggcgcgcggcctc
aagcagatcagcgacagcggcgccatcggcgccatgatcgacgaagtcctggcggccaac
cccgccatcgtcgaggaataccgggccggcaagcagaaagccttcaactcgctggtcggc
cagatcatgaaggccgccaagggcaaggccaacccccagcaggtcaacgagctgctgaag
gaaaaactgggctga

DBGET integrated database retrieval system