KEGG   Bordetella pertussis 137: Q425_34760Help
Entry
Q425_34760        CDS       T03754                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q425_34760
Enzymes [BR:bpeu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Q425_34760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF4375 RbcS
Motif
Other DBs
NCBI-ProteinID: AJB27946
LinkDB All DBs
Position
complement(3673393..3674853)
Genome map
AA seq 486 aa AA seqDB search
MEDLRNHEFKNYIGGQWVACAAGKTYPNVNPADTDDIVGRFQASQAEDAAAAVAAAQAAF
DGWRNLAVSKRAALMQRAADYLEAHAEQFGRELTREEGKALNLAKDEVLRSAQTIRFYAA
EGQSFSGETFVNDDPDMVVYSQREPLGVVTVISPWNFPVSIPARKIAPALITGNTVVFKP
SSDAPLSGLRLVEAFEQAGLPPGVLNLVTGSASAIGAAITQASQVRAVSFTGSTAAGEQI
HRSVDMTTRTQMELGGKNPLIVMADADLDRAVDLVVKGGFSLSGQACTGTSRVLVDAPVK
AAFTEKLLAKVKALKVGNSLEGSFDLGPLATARQLESVMRYIEVGKQEARLLCGGERLEG
PGYERGYYLTPAVFADVTQQMRIAREEIFGPVIALIEVNGYEDAIAKANDTEYGLAAAIA
TTNAQYAHRFARDIQAGTVKINRTTTGNLINAPFGGLKRSSTSTFRESGRIGLEFYTQIK
TVYRAG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctccggaaccacgagttcaagaactatatcggcgggcaatgggtcgcctgc
gccgcgggcaagacctatcccaacgtaaacccggccgacaccgacgacatcgtgggccgc
ttccaggcctcgcaggccgaggatgcggccgcggcggtggccgccgcgcaggccgccttc
gacggttggcgcaacctggccgtgtccaagcgcgccgcgctgatgcagcgcgccgccgac
tacctggaggcgcacgccgagcagttcggccgcgagctgacgcgcgaggaaggcaaggcg
ctgaacctggccaaggacgaagtcctgcgctcggcgcagaccatccgcttctacgcggcc
gagggccagtcgttcagcggcgaaaccttcgtcaacgacgatccggacatggtcgtgtac
agccagcgcgagccgctgggcgtggtgacggtgatctcgccgtggaacttcccggtgtcg
atcccggcgcgcaagatcgccccggcgctgatcaccggcaataccgtggtgttcaagcct
tcctcggatgcgccgctgtccggcctgcgcctggtcgaggcgttcgagcaggcgggcctg
ccgcccggggtgctgaacctggtgaccggcagcgcctcggccatcggcgcggcgatcacc
caggcgtcgcaggtgcgcgcggtgtcgttcaccggctcgaccgcggcgggcgagcagatc
caccgctcggtggacatgaccacccgcacgcaaatggagctgggcggcaagaacccgctg
atcgtcatggccgatgccgacctggaccgcgccgtggatctggtcgtcaagggcggtttt
tcgctcagcggccaggcctgcacgggaaccagccgcgtgctggtggacgcgccggtcaag
gcggccttcaccgagaagctgctggccaaggtcaaggccctgaaagtgggcaacagcctg
gaaggcagtttcgacctgggtccgctggccaccgccaggcagctcgaatcggtgatgcgc
tacatcgaggtgggcaagcaggaggcccggctgctgtgtggcggcgaacggctggaaggc
ccgggctacgaacgcggctactacctcaccccggcggtctttgccgacgtcacgcagcag
atgcgcatcgcccgcgaggagatcttcgggccggtcatcgcgctgatcgaggtcaatggc
tatgaagacgccatcgccaaggccaacgacaccgaatacggcctggccgcggccatcgcc
accaccaatgcgcagtacgcgcaccgtttcgcgcgcgatatccaggccggcacggtgaag
atcaaccgcaccaccacgggcaacctgatcaatgcgccgttcggcggcctgaagcgctcc
agcacctcgacgttccgcgagtcgggccgcatcgggctggagttctatacccagatcaag
acggtctaccgcgccggctga

DBGET integrated database retrieval system