KEGG   Bordetella pertussis 137: Q425_5060Help
Entry
Q425_5060         CDS       T03754                                 

Definition
(GenBank) hydrolase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00630  Glyoxylate and dicarboxylate metabolism
bpeu01100  Metabolic pathways
bpeu01110  Biosynthesis of secondary metabolites
bpeu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Q425_5060
Enzymes [BR:bpeu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     Q425_5060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AJB25334
LinkDB All DBs
Position
complement(497257..497928)
Genome map
AA seq 223 aa AA seqDB search
MGYSLVVFDWDGTLMDSTHSIVAAIQGACRDLDLPVPSASSASWVIGLSLESALRRAVPE
LTQAMVPRFLERYRTHYLLRDSELRLFEGVRELLADLASQDVRLAVATGKSRVGLNRALA
ATGLGPLFDATRTADETFSKPHPAMLQELMHELGHEADAVVMVGDTSHDLQMAANAGVHG
LGVAYGAHTLAELEACAPQAVVDSVAVLREWLLARSPGRIESV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgggttattcgttggtggtattcgattgggatggaaccttgatggattccactcacagc
atcgtggcggccatacagggggcttgccgcgatctggacctgcctgtgccgtcggcgtcg
tcggccagctgggtgatcggcctgtcgctggaaagcgcgctgcgccgggccgtgcccgaa
ttgacgcaggccatggtgccgcgttttctcgagcgctaccggacccactacctgctgcgc
gactcggagctgcgcctgttcgaaggcgtgcgcgaactgctggccgacctggccagccag
gacgtccgcctggcggtcgccaccggcaagagccgcgtggggctgaaccgggccttggcc
gccaccgggctcgggccgctgttcgacgccacccgcacggccgatgaaaccttcagcaaa
ccccacccggcgatgttgcaggaactcatgcacgagctcgggcacgaggccgacgccgtg
gtcatggtgggggatacctcgcacgacctgcagatggcggccaacgccggcgtgcacggc
ctgggtgtcgcctatggcgcccataccttggcggagctggaggcctgtgccccgcaggcg
gtggtcgacagcgtggccgtgttgcgcgaatggctgctggcgcgctcgccgggccgcatc
gagagcgtgtag

DBGET integrated database retrieval system