KEGG   Bacillus pseudofirmus: BpOF4_00425Help
Entry
BpOF4_00425       CDS       T01165                                 

Gene name
prkC
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bpf  Bacillus pseudofirmus
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpf01001]
    BpOF4_00425 (prkC)
Enzymes [BR:bpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BpOF4_00425 (prkC)
Protein kinases [BR:bpf01001]
 Serine/threonine kinases: Other
  Bacterial family
   BpOF4_00425 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA DUF4366 APH Kdo Kinase-like RIO1 Wzz Haspin_kinase Pkinase_fungal DUF5345 PBP_N
Motif
Other DBs
NCBI-ProteinID: ADC48154
UniProt: D3FT86
LinkDB All DBs
Position
complement(2362422..2364506)
Genome map
AA seq 694 aa AA seqDB search
MIGTRIAGRYQILEVIGGGGMANVYKALDVILDRHVAVKVLQPQFSEDEQFIKRFRREAQ
AATSLNHPNVVNIFDVGEEGNTYYIVMEYVEGFTLKELIQSEGPLPVEKVLDLLKQMMAA
ISHAHANQIIHRDIKPHNILVSKDGVAKVTDFGIARAISSATITHTNSVMGSVHYLSPEQ
ARGGHVTYRSDIYSMGIVLFEMVTGTLPFKGDTAVSIAIKHLQNEVPSAKSIVPGLPQSI
ENVIRRSTIKDPLKRYASIHDMEEDVETVLNPDRLNENVYYANDVEEDMTKAIPIIKDDD
LKEDDVDKTIEIKSNERTAPVAAPAPPPKPASEQAEAGEEPAPKKKKKKKWLIISLIALF
LLIGSTAAAFVLFPNLFYVAEVEVPDVVGMPYEEAEEELLGLNLVVEREDEEIEGVEPGH
VARQSQRAGSRVKEQSRVVLYVNIEDASFELDDVIGLPIERAERLLDEQGLTVERIEQED
TTQTPGIVTEQRPSAGETVVAGETTVYLTYAVQSEIRLRNLEGEREDAAREYLTEVGLNG
RFQNEYSDSVEAGLIIRQSPGAFTMLQPGDDVQLIVSRGPREEEPPPASEDTPEDSGSTE
EPDPEPETPATKQYEVNQPVDVSQEDQEAGNSYEIRIIYRDATTNGADEVFVEESITEPK
TYSIPLEVSEEYPGSFDVYVNGNQAHSSKQYTFN
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgataggtactcgtattgcgggccgatatcaaattcttgaagtaatcggcggcggcgga
atggcaaatgtgtataaagcattagatgtcattttagaccgtcatgttgcagtaaaagtt
ctccaaccacagttctcagaagatgaacagtttattaaacgttttcgccgggaagcacaa
gctgcaacaagtttaaaccatccgaatgtcgttaatatttttgatgtcggagaagagggc
aatacgtattacattgtaatggaatacgtagaaggatttacgttgaaagaattaattcaa
tcggaaggtcctctgcctgttgaaaaggtgcttgatctgctcaagcaaatgatggctgcg
atctcacatgcccatgcgaaccaaattatccaccgtgatattaaaccgcataatatatta
gtgagtaaggacggcgttgcgaaggtcacagattttggaattgcgcgtgcgatttcatcg
gctacgatcacgcatactaattcagttatgggttctgtgcattatttgtccccagaacaa
gcccgcggaggtcatgttacgtaccgctctgacatttattctatgggaattgtcttgttt
gaaatggtcacaggtacgctgccttttaagggtgatacggccgtgtctattgcaattaag
caccttcaaaatgaggtgccttctgcaaaatcgatcgtcccaggactgccacaaagtatt
gaaaatgtgattagaaggtcgacaattaaagatccgttaaaaagatatgcatcgattcat
gatatggaagaagatgtcgaaacggtcttaaatccagacagactaaatgaaaatgtatat
tatgctaatgatgttgaagaagacatgacaaaggctattcctatcattaaagatgacgat
ttaaaagaagatgatgttgacaaaacaattgaaataaaatccaatgaacgcacggcacct
gttgctgcccccgcaccgcctccaaagcctgcgtctgagcaagctgaggcaggagaagag
cctgcacctaaaaagaaaaagaagaaaaaatggctgattatcagtcttatagcgttgttt
ttattaatcggttctacggcagcggcttttgtcctgtttcctaatctcttctatgtggca
gaggttgaagttcctgatgttgttggtatgccgtatgaagaggctgaagaagagcttctt
ggccttaaccttgtggtcgagcgcgaggatgaggagatagaaggtgttgaacctggtcat
gttgcgcggcaaagccaaagggcaggttcgagagtaaaggaacaatcaagggtggtccta
tatgttaatatagaagacgcgagctttgaactcgatgatgtcattgggcttcctattgaa
agggcagagcgccttctcgatgaacaaggcttaacggtcgaacgcattgagcaggaagat
acgacccaaacacctggcatcgttaccgagcagcgtcctagtgctggtgaaacagtggta
gcaggtgaaacaacggtttatttaacgtatgcggttcaatcagagattaggcttcgtaat
ttagagggcgaacgggaagatgccgcacgtgagtatttaactgaggtaggcttaaacggc
cgtttccaaaatgaatactctgattcagtggaggcaggtctcatcatacgtcaatcacct
ggagcatttacgatgctgcagccgggtgatgatgtgcagttaattgtctcaagaggacct
agagaagaagaaccacccccagcgtcagaggatacgccagaagatagcggaagcaccgaa
gagccagatcctgaaccagaaacaccagcaacaaaacaatatgaagtcaatcagcctgtt
gacgtatcgcaagaggaccaagaggccggtaatagttatgagatccgcatcatatatcgt
gatgcgacaacaaatggggctgatgaagtatttgttgaggaatcaataactgaaccgaaa
acctattccatacctctagaggtaagtgaggaatacccaggttcatttgatgtttatgtc
aacggaaaccaagctcatagttctaagcaatatacattcaattaa

DBGET integrated database retrieval system