KEGG   Bacillus pseudofirmus: BpOF4_01710Help
Entry
BpOF4_01710       CDS       T01165                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01130  Biosynthesis of antibiotics
bpf01230  Biosynthesis of amino acids
Module
bpf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BpOF4_01710 (aroK)
Enzymes [BR:bpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BpOF4_01710 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 CoaE AAA_33 AAA_17 ATP_bind_2 Cytidylate_kin2 APS_kinase Cytidylate_kin dNK TsaE AAA AAA_28 cobW AAA_22 KTI12 tRNA_lig_kinase Rad17 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADC48410
UniProt: D3FUY4
LinkDB All DBs
Position
complement(2607798..2608298)
Genome map
AA seq 166 aa AA seqDB search
MNDRIYLTGFMGSGKTTVGQALGKALGYQVIDTDQWIEEDQQKKIKEIFNEGGEKLFRSL
ETAALRELTQKKAVITTGGGIILKEENRQIMKGSGTVIFLDCAIEEVIRRTSNDDSRPLL
KEKSKGDIQSMYEDRLPLYKEADIHLDTTGRSILEIVAELKSAMLK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcgaatttatcttactggatttatgggttctggtaaaacaacggtaggccaa
gctttaggcaaagcgttaggatatcaggttatcgatacggatcaatggattgaagaagat
caacaaaagaaaatcaaagaaatttttaatgaagggggagaaaagctttttaggagtctt
gaaacggcagcattaagagagttaactcaaaaaaaagctgtaattacaaccggcggcggg
atcattctaaaagaggaaaatcgacaaattatgaaagggtctggaacagtgatatttcta
gactgtgccatcgaagaagttattcgccggacgtctaatgatgattctaggccgttgctt
aaagagaaatctaaaggtgatattcaatccatgtacgaagaccgcttgccgttatataaa
gaagcagatatccacttagacactacagggaggtccattcttgaaatcgttgctgagttg
aagtcagctatgcttaaataa

DBGET integrated database retrieval system